triangle PDBeMotif: 3pzd  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification motor protein/apoptosis    | release date: Tue, Dec 14, 2010
Title structure of the myosin x myth4-ferm/dcc complex
Authors J.YAN, L.PAN, M.ZHANG, Z.WEI
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Small molecules:    search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
EFDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLE
SMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQF
PGSEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRN
MFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHH
PAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARISQSTKTQMLDMWIKEEVSSARASIIDKWRKFQGMNQ
EQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDE
RELLFETSEVVDVAKLMKAYISMIVKKRYST
Chain B sequence:
HKPTEDPASVYEQDDLSEQMASLEGLMKQLNAITGS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MYOSIN-X
member of: GENE3D:searchG3DSA_1.20.80.10/searchG3DSA_2.30.29.30PFAM:searchPF00373/searchPF00784PROSITE PROFILES:searchPS50057/searchPS51016, SMART:searchSM00139/searchSM00295SUPERFAMILY:searchSSF47031/searchSSF50729UniProt:searchQ9HD67
JMol viewer RasMol script viewer  GOL 1A  ..                                                                                                                                                                                                             ***                                                                                                **  *                                                      ..GOL ..                                                      ..                                                                                 
sec str:  .....hhhhhhhhhhhh...hhhhhhhhhhhhhhhh..................hhhhhhhh...hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.........hhhhhhhhhh...eeeeee.....eeeeee....hhhhhhhhhhhhh.......eeeeeee....eee.....hhhhhhhhhhhhh..........eeeeeeee..........hhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh.........hhhhh..hhhhhh.... ..hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh.......eeeeee.......eeeeee...eeeeee.......eeee...eeeee.....eeeeee..eeeeee..hhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..EFDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLESMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGSEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKAR... ..DMWIKEEVSSARASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECK..FPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYST
seq num:  ..1501      1511      1521      1531      1541      1551      1561      1571      1581      1591      1601      1611      1621      1631      1641      1651      1661      1671      1681      1691      1701      1711      1721      1731      1741      1751      1761      1771      1781      1791      1801      1811      1821      1831      1841      1851         ... ..1910      1920      1930      1940      1950          ..1967      1977      1987      1997      2007      2017      2027      2037       
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   |   |    |  |  |          || || | |           | ||||  | ||| |  ||            |  |      |   || | |      |  | | |||  | ||   |       ||  ||                    |  |  ||       |||||       |  |   | |||       | |||| |   | |||  ||    || |||| | |       | |     |  |            |  ||  |             ||| ||  |               ||||                      |  |     |  |    |  |..PS00004..         | | |  | || || ||   |       |  | || ||  |    ..         |  |    |  | | ||  || |||| |    || |  |  |     | |                 **^* 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |   |    |  |  |          || || | |           | ||||  | ||| |  ||            |  |      |   || | |      |  | | ^**  | ||   |       ||  ||                    |  |  ||       ^**||       |  |   | |||       | |||^**   | |||  ||    || |||| | |       | |     |  |            |  ||  |             ||| ||  |               ||||                      |  |     |  |    |  |..PS00005..         ^** |  | || || ||   |       |  | || ||  |    ..         |  |    |  | | ||  || |||| |    |^**  |  |     | |                      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |   |    |  |  |          || || | |           | ||||  | ||| ^***|            ^***      |   ^*** |      |  | | ||   | ||   |       ||  ||                    |  ^***|       || ||       ^***   | |||       | |||  |   | ||^***|    || |||| | |       | |     |  |            |  ||  |             ||| ||  |               ||||                      |  |     |  |    |  |..PS00006..             ^*** || || ||   |       |  | || |^***    ..         |  |    |  | | ||  || |||| |    |     |  |     | |                      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   |   |    |  |  |          || || | |           | ||||  | ||| |   |                      |   ||   *******^  | | ||   | ||   |       ||  ||                    |  |   |       || ||              | |||       | |||  |   | |||   |    || |||| | |       | |     |  |            |  ||  |             ||| ||  |               ||||                      |  |     |  |    |  |..PS00007..                  || || ||   |       |  | || |        ..         |  |    |  | *******^ |||| |    |     |  |     | |                      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |   |    |  |  |          || || | |           | ||||  | ||| |   |                      ^*****             | | ||   | ^*****       ||  ||                    |  |   |       || ||              | |||       | ^*****   | |||   |    || |||| | |       | |     |  |            |  ||  |             ||| ||  |               ||||                      |  |     |  |    |  |..PS00008..                  || || ||   |       |  | || |        ..         |  |    |  | | ||  || |||| ^*****     |  |     | |                      
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..   |   |    |  |  |          || **********************|  | ||| |   |                      |   |              | | ||   |  |   |       ||  ||                    |  |   |       || ||              | |||       | |||      | |||   |    || |||| | |       | |     |  |            |  ||  |             ||| ||  |               ||||                      |  |     |  |    |  |..PS00029..                  || || ||   |       |  | || |        ..         |  |    |  | | ||  || ||||            |  |     | |                      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |   |    |  |  |          || || | |           | || |  | ||| |   |                      |   |              | | ||   |  |   |       |*****                    |  |   |       || ||              | |||       | |||      | |||   |    || |||| | |       | |     |  |            |  ||  |             ||| ||  |               ||||                      |  |     |  |    |  |..alphabetamotif..                  || || ||   |       |  | || |        ..         |  |    |  | | ||  || ||||            |  |     | |                      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   |   |    |  |  |          || || | |           | || |  | ||| |   |                      |   |              | | ||   |  |   |       ||  |                     |  |   |       || ||              | |||       | |||      | |||   |    || |||| | |       | |     |  |            |  ||  |             ||| ||  |               ||||                      |  |     |  |    |  |..asxmotif..                  || || |*****       |  | || |        ..         |  |    |  | | ||  || ||||            |  |     | |                      
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |   |    |  |  |          || || | |           | |***  | ||| |   |                      |   |              | | ||   |  |   |       ||  |                     |  |   |       || ||              | |||       | |||      ***||   |    || |||| | |       ***     |  |            |  ||  |             *** ||  |               ||||                      |  |     |  |    |  |..asxturn..                  || || |            |  | || |        ..         |  |    |  | | ||  || ||||            |  |     | |                      
search RasMol script viewer Motif-ligand binding stats  betabulge ..   |   |    |  |  |          || || | |           | |     | ||| |   |                      |   |              | | ||   |  |   |       ||  |                     |  |   |       || ||              | |||       | |||      |  ||   |    || |||| | |               |  |            |  ||  |              |  ||  |               ||||                      |  |     |  |    |  |..betabulge..                  || || |            |  | || |        ..         |  |    |  | | **  || ||**            |  |     | |                      
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |   |    ****  |          ****| | |           | |     ****| |   |                      |   |              | ****   |  |   |       |****                     |  |   |       ****|              ****|       ****|      |  ||   |    |****|| | |               |  |            |  |****              |  ||  |               ||||                      |  |     |  |    ****..betaturn..                  ****| |            |  | ****        ..         |  |    **** |     ****|              ****     | |                      
search RasMol script viewer Motif-ligand binding stats  nest ..   |   |       |  |           |  | | |           | |       *** |   |                      |   |              | | ||   |  |   |       |   |                     |  |   |       ||  |                ***         ***      |  ||   |    |  **** | |               |  |            |  ||  |              |  ||  |               ****                      |  |     |  |        ..nest..                   | || |            |  | || |        ..         |  |    |  | |      |  |              |  |     | |                      
search RasMol script viewer Motif-ligand binding stats  niche ..   |   |       ****           **** ***           ***           |   |                      |   |              | ****   ****   |       |   |                     ****   |       |****                                     ****|   |    |    ******               ****            ********              ********                                         ****     ****        ..niche..                   ******            *********        ..         ****    ******      ****              ****     | |                      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..   |   |                           | |                         |   |                      |   |              |   |       |   |       |   |                        |   |       |   |                                         |   |    ******  | |                                                                                                                           ..schellmannloop..                                                      ..                                                        | |                      
search RasMol script viewer Motif-ligand binding stats  stmotif ..   *****                           | |                         *****                      |   |              |   |       *****       |   |                        *****       |   |                                         *****            | |                                                                                                                           ..stmotif..                                                      ..                                                        | |                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                   | |                                                    *****              *****                   *****                                    *****                                                          | |                                                                                                                           ..ststaple..                                                      ..                                                        | |                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                   ***                                                                                                                                                                                                       ***                                                                                                                           ..stturn..                                                      ..                                                        ***                      

chain B : NETRIN RECEPTOR DCC
member of: PANTHER:searchPTHR10489/searchPTHR10489_SF68PFAM:searchPF06583UniProt:searchP70211
sec str:  .......hhhhhhhh.hhhhhhhhhhhhhhhhhhhhh.
sequence :  ..HKPTEDPASVYEQDDLSEQMASLEGLMKQLNAITGS
seq num:  ..1408      1418      1428      1438  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | |  ^***|                |   | |
search RasMol script viewer Motif-ligand binding stats  nest ..   | |   |  |                |   ***
search RasMol script viewer Motif-ligand binding stats  niche ..   ***   ****                |   |  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                             *****  

   New search    3pzd:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors