triangle PDBeMotif: 3ps8  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification hydrolase inhibitor    | release date: Wed, Dec 1, 2010
Title crystal structure of l68v mutant of human cystatin c
Authors A.SZYMANSKA, D.BOREK, M.ORLIKOWSKA, P.SKOWRON, Z.OTWINOWSKI
Method X-RAY DIFFRACTION (resolution: 2.55Å)
PDBe Citation   
Small molecules:    search ACT ACT binding statistics ACT   search PEG PEG binding statistics PEG
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVEVGRTTCTKTQPNL
DNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYSTATIN-C
member of: CATH:search3.10.450.10GENE3D:searchG3DSA_3.10.450.10PANTHER:searchPTHR11413/searchPTHR11413_SF42PFAM:searchPF00031PROSITE PATTERNS:searchPS00287, SMART:searchSM00043SUPERFAMILY:searchSSF54403UniProt:searchP01034
JMol viewer RasMol script viewer  ACT 124A  ..                      *         *                       ***                      *                           
JMol viewer RasMol script viewer  PEG 123A  ..                      |         |                       |||                      |      * *                  
JMol viewer RasMol script viewer  PEG 122A  ..                      |         |      * *              |||                      |      | |                  
JMol viewer RasMol script viewer  PEG 121A  ..                      |         |      * |              |||                      |      | |                  
sec str:  ....ee....hhhhhhhhhhhhhhhhhhh..............ee.....eeeeeeeeee.........hhhhh..........eeeeeeeeeee....eeeeeeeeeee.
sequence :  ..GPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVEVGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
seq num:  ..12        22        32        42        52        62        72        82        92        102       112      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     ^*** |    |       |  | | |           |            |   | ||  | | |    | ||  |              | |   || ^*** 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | || ^*****       |  | | |           |            |   | ||  | | |    | ||  |              | |   ||      
search RasMol script viewer Motif-ligand binding stats  CYSTATIN ..     | ||              |  | | |           **************   | ||  | | |    | ||  |              | |   ||      
search RasMol script viewer Motif-ligand binding stats  asxturn ..     | ||              |  | ***                            | ||  | | |    | ||  |              | |   ||      
search RasMol script viewer Motif-ligand binding stats  betabulge ..     | ||              |  | | |                            | ||  | | |    | ||  |              | |   **      
search RasMol script viewer Motif-ligand binding stats  nest ..     | ||              |  | | |                            | ||  | ***    | ||  |              ***           
search RasMol script viewer Motif-ligand binding stats  niche ..     ****              ********                            *******        *******                            
search RasMol script viewer Motif-ligand binding stats  stturn ..     ***                                                                                                     

   New search    3ps8:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors