triangle PDBeMotif: 3poz  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.10.1
Classification transferase/transferase inhibitor    | release date: Tue, Nov 23, 2010
Title egfr kinase domain complexed with tak-285
Authors K.AERTGEERTS, R.SKENE, S.SOGABE
Method X-RAY DIFFRACTION (resolution: 1.50Å)
PDBe Citation   
Small molecules:    search 03P 03P binding statistics 03P   search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVC
RLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITD
FGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQ
PPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADE
YLIPQQG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EPIDERMAL GROWTH FACTOR RECEPTOR
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20/searchG3DSA_4.10.1140.10PANTHER:searchPTHR24416/searchPTHR24416_SF91PFAM:searchPF07714PIRSF:searchPIRSF000619PRINTS:searchTYRKINASEPROSITE PATTERNS:searchPS00107/searchPS00109, PROSITE PROFILES:searchPS50011, SMART:searchSM00219SUPERFAMILY:searchSSF56112UniProt:searchP00533
JMol viewer RasMol script viewer  03P 1023A  ..                         *       ..     * *  ..           *        ***          * ** *                                               *  *         ***           ..03P ..                                                                                                                                 ..        
JMol viewer RasMol script viewer  SO4 3A  ..                         |       ..     | |  ..           |        |||          | || |                                      *** *    |  |         |||   *       ..SO4 ..                                                                                                                                 ..        
JMol viewer RasMol script viewer  SO4 2A  ..                         |       ..     | |  ..           |        |||          | || |           *                          ||| |    |  |         |||   |       ..SO4 ..                                                                                                                   *    ***      ..        
JMol viewer RasMol script viewer  SO4 1A  ..                         |       ..     | |  ..           |        |||          | || |         * |                          ||| |    |  |         |||   |       ..SO4 ..                                      *                                                                            |    |||      ..        
sec str:  ......ee.hhh.eeeeeeeeee..eeeeeeee......eeeeeee...hhhhhhhhhhhhhhh.......eeeeee...eeeeee.....hhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.......hhh.eeeee..eeee...hhhhhhh....... ....hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhh...hhhhh.......hhhhhhhhh....hhhhhh
sequence :  ..QALLRILKETEFKKIKVLGSGAFGTVYKGLWIP..VKIPVAIKEL..ANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEK... ..KVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMD..VVDADEYL
seq num:  ..701       711       721          ..738       ..755       765       775       785       795       805       815       825       835       845       855          ... ..875       885       895       905       915       925       935       945       955       965       975       985       995      ..1010    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |   || ||     |  |    |       ..       |  ..| |||    | |  | |  |    |   |||                   || ||                   | ||| | | ||||| | | ||| |  || |  ||||| ..PS00005..   |  ||  || | | |   |      | ||  | | | ||||   |  | |||||    |  |        || || ||  |           |     | ||   ||| |   || ||        ..        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |   || ||     |  |    |       ..       |  ..| |||    | |  | |  |    |   |||                   || ||                   | ||| | | ||||| | | ||| |  || |  ||||| ..PS00006..   |  ||  || | | |   |      ^***  | | | ||||   |  ^***|||    |  |        || || ||  |           |     | ||   ||| |   ^***|        ..        
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. | |   || ||     |  |    |       ..       |  ..| *******^ |  | |  |    |   |||                   || ||                   | ||| | | ||||| | | ||| |  || |  ||||| ..PS00007..   |  ||  || | | |   |        |   | | | ||||   |    | |||    |  |        || || ||  |           ********^|   ||| |    |  |        ..        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |   || ||     |  ^*****       ..       |  ..|  ||      |  | |  |    ^*****|                   || ||                   | ||| | | ||||| | | ||| |  || |  ||||| ..PS00008..   |  ||  || | | |   |        |   | | | ||^*****    | |||    |  |        || || ||  |                 |  |   ||| |    |  |        ..        
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP .. | |   || ||     ****************..********  ..|  ||      |  | |  |        | |                   || ||                   | ||| | | ||||| | | ||| |  || |  ||||| ..PS00107..   |  ||  || | | |   |        |   | | | || |        | |||    |  |        || || ||  |                 |  |   ||| |    |  |        ..        
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_TYR .. | |   || ||                     ..          ..|  ||      |  | |  |        | |                   || ||                   | ||****^******** | ||| |  || |  ||||| ..PS00109..   |  ||  || | | |   |        |   | | | || |        | |||    |  |        || || ||  |                 |  |   ||| |    |  |        ..        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |   || ||                     ..          ..*****      |  | |  |        | |                   || ||                   | ||| | | |||||   | ||| |  || |  ||||| ..alphabetamotif..   |  |***** | | |   |        |   | | | || |        | |||    |  |        || || ||  |                 |  |   ||| |    |  |        ..        
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |   ****|                     ..          ..****       |  | |  |        | |                   ****|                   ****| | | ****|   ****| |  || |  ||||| ..betaturn..   ********  | | |   |        |   | | | ****        ****|    ****        ****| ||  |                 |  |   ||| |    |  |        ..        
search RasMol script viewer Motif-ligand binding stats  nest .. | |    |  |                     ..          ..           |  | |  |        | |                    |  |                     *** ***  || |   | ||| |  |***  ****| ..nest..   |  |      *** |   |        |   *** | || |          ***    |  |         |  | ||  |                 |  |   *** |    |  |        ..        
search RasMol script viewer Motif-ligand binding stats  niche .. ***    ****                     ..          ..           **** ****        | |                    ****                           |  ****   ****| ****      **** ..niche..   ****          |   |        |   |   ******                 ****         **********                 ****    ****    ****        ..        
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                 ..          ..                            | |                                                   |   |     *****                ..stmotif..                 *****        |   |                                                                                              ..        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                 ..          ..                            | |                                                   |   |     | |                  ..ststaple..                              *****                                                                                              ..        
search RasMol script viewer Motif-ligand binding stats  stturn ..                                 ..          ..                            ***                                                   |   |     ***                  ..stturn..                                                                                                                                 ..        
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                 ..          ..                                                                                  *   *                          ..REP00000..                                                                                                                                 ..        

   New search    3poz:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors