triangle PDBeMotif: 3pla  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.1.1.
Classification transferase/rna    | release date: Mon, Nov 15, 2010
Title crystal structure of a catalytically active substrate-bound rnp from sulfolobus solfataricus
Authors A.XU, J.LIN, J.LU, K.YE, L.ZHANG, R.JIA, S.LAI
Method X-RAY DIFFRACTION (resolution: 3.15Å)
PDBe Citation   
Small molecules:    search U U binding statistics U   search SAH SAH binding statistics SAH
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,K sequence:
MVKIYLIEHVIGAVAYDENGNIVDYITNPRDLGKITEELLNNEKGIPFSATVELLKKVNPQEVVVENEAEVPKLQALGYR
VSYEPYSKVSRIFRESLPKVAIDIKFASNEEDYYNFLHELSLEYTRRKLRSAAQKRDLLAIQAVRAMDDIDKTINLFSER
LREWYSIHFPELDKLIEDHEEYATIVSRFGDRGFLTIDSLKELGFNEQRINRILDAAKKSIGADISEDDLSAMRMIANTI
LDLYNIRRNLNNYLEGVMKEVAPNVTALVGPALGARLLSIAGSLDELAKMPASTIQVLGAEKALFRALRSGGRPPKHGII
FQYPAIHTSPRWQRGKIARALAAKLAIAARVDAFSGRFIGDQLNEQLKKRIDEIKEKFAQHHHHHHHH
Chains C,D,L sequence:
MDAMSKASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPY
VYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKTSS
Chains E,F,M sequence:
MAEVITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKV
LYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQT
DIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYKG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PRE MRNA SPLICING PROTEIN
member of: PANTHER:searchPTHR10894PFAM:searchPF01798/searchPF08060PROSITE PROFILES:searchPS51358, SMART:searchSM00931SUPERFAMILY:searchSSF89124UniProt:searchQ97ZH3
sec str:  ...eeeeee..eeeee.....eeeeee...hhhhhhhhhhhhhh...hhhhhhhhhhh...eeee....hhhhhhhh..eeee...hhhhhhhhhh..hhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhh.hhhhhhhhhhhh...hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhh...hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh.
sequence :  ..KIYLIEHVIGAVAYDENGNIVDYITNPRDLGKITEELLNNEKGIPFSATVELLKKVNPQEVVVENEAEVPKLQALGYRVSYEPYSKVSRIFRESLPKVAIDIKFASNEEDYYNFLHELSLEYTRRKLRSAAQKRDLLAIQAVRAMDDIDKTINLFSERLREWYSIHFPELDKLIEDHEEYATIVSRFGDRGFLTIDSLKELGFNEQRINRILDAAKKSIGADISEDDLSAMRMIANTILDLYNIRRNLNNYLEGVMKEVAPNVTALVGPALGARLLSIAGSLDELAKMPASTIQVLGAEKALFRALRSGGRPPKHGIIFQYPAIHTSPRWQRGKIARALAAKLAIAARVDAFSGRFIGDQLNEQLKKRIDEIKEK
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                | |                      |||   |                          | |                      | |||||  |             | |   ||  |                  |   | |            || | | | | |      ||| |   | ||| |           |  | |   || |||   |   |  |                   | ^***             | |  ||  |   || |||| | | |   | |       |  |||| || |                      ||||                    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                | |                      |||   |                          | |                      | |||||  |             ^**   ||  |                  |   ^**            || | | | | |      ||| |   ^**|| |           |  | |   || |||   |   |  |                   |   |              | |  ||  |   || |||| | | |   | |       |  |||| |^**                      |^**                    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                | |                      |||   |                          | |                      | ||||^***               |   ||  |                  |   |              || | | | | |      ||| |   ^***| |           |  | |   ^***||   |   ^***                   |   |              | ^***|  |   || |||| | | |   | |       |  |||| ||                        | |                     
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                | |                      |||   |                          | |                      | ||||                   |   ||  |                  |   |              |********^ |      ||| |       | |           |  | |   ||  ||   |   |                      |   |              | |   |  |   || |||| | | |   | |       |  |||| ||                        | |                     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                | |                      |^*****                          | |                      | ||||                   |   ||  |                  |   |              |  | | | | |      ||| |       | |           |  | ^*****  ||   |   |                      |   |              | |   |  |   || ||^***** |   | |       |  |||| ||                        | |                     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                | |                      | |                              | |                      | ||||                   |   ||  |                  |   |              |  | | | | |      ||| |       | |           |  | |   ||  ||   |   |                      |   |              | |   |  |   ***** | |   |   | |       |  |||| ||                        | |                     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                | |                      | |                              | |                      | ||||                   |   ||  |                  |   |              |  | ***** |      ||| |       | |           |  | |   ||  ||   |   |                      |   |              | |   |  |   || || | |   |   | |       |  |||| ||                        | |                     
search RasMol script viewer Motif-ligand binding stats  asxturn ..                | |                      | |                              | |                      | ||||                   |   ||  |                  |   |              |  | | |   |      *** |       | |           |  | |   ||  ||   |   |                      |   |              | |   |  |   || || | |   |   | |       |  |||| ||                        | |                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                | |                      | |                              | |                      ****||                   |   ||  |                  |   |              |  | | |   |       |  |       | |           |  | |   ||  ||   |   |                      |   |              | |   |  |   ****| | |   |   | |       |  **** ||                        | |                     
search RasMol script viewer Motif-ligand binding stats  nest ..                ***                      ***                              ***                        ****                   |   ||  |                  |   |              |  | | |   |       |  |       ***           |  | |   ||  ||   |   |                      |   |              ***   |  |    |  | ***   |   ***       |  |||| ||                        ***                     
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                                                                            |   |****                  |   |              ****** |   |       ****                     **** |   ||  ||   |   |                      |   |                    ****    ****       |   |         ****||****                                                
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                                            |   |                      |   |                     |   |                                   | |   *****|   |   |                      |   |                                       |   |             ||  ||                                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                            *****                      *****                     *****                                   | |    *****   *****                      *****                                       *****             ******                                                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                         ***                                                                                                                                                           

chain B : PRE MRNA SPLICING PROTEIN
member of: PANTHER:searchPTHR10894PFAM:searchPF01798/searchPF08060PROSITE PROFILES:searchPS51358, SMART:searchSM00931SUPERFAMILY:searchSSF89124UniProt:searchQ97ZH3
sec str:  ...eeeeee..eeeee.....eeeeee...hhhhhhhhhhhhh....hhhhhhhhhhh...eeee....hhhhhhh...eeee...hhhhhhhhhh..hhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhh.hhhhhhhhhhhh...hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhh...hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh..
sequence :  ..KIYLIEHVIGAVAYDENGNIVDYITNPRDLGKITEELLNNEKGIPFSATVELLKKVNPQEVVVENEAEVPKLQALGYRVSYEPYSKVSRIFRESLPKVAIDIKFASNEEDYYNFLHELSLEYTRRKLRSAAQKRDLLAIQAVRAMDDIDKTINLFSERLREWYSIHFPELDKLIEDHEEYATIVSRFGDRGFLTIDSLKELGFNEQRINRILDAAKKSIGADISEDDLSAMRMIANTILDLYNIRRNLNNYLEGVMKEVAPNVTALVGPALGARLLSIAGSLDELAKMPASTIQVLGAEKALFRALRSGGRPPKHGIIFQYPAIHTSPRWQRGKIARALAAKLAIAARVDAFSGRFIGDQLNEQLKKRIDEIKEK
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      |  |      | |                    | |||   |    |  |                  | |                        |||||  |             | |   ||  |                  |   | |            || | | | | |      ||| |   | ||              |  | |   || |||   |   |  |                   | ^***             | |  ||  |   || |||| | | |   | |       |  |||| || |                       | |                    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      |  |      | |                    | |||   |    |  |                  | |                        |||||  |             ^**   ||  |                  |   ^**            || | | | | |      ||| |   ^**|              |  | |   || |||   |   |  |                   |   |              | |  ||  |   || |||| | | |   | |       |  |||| |^**                       ^**                    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      |  |      | |                    | |||   |    |  |                  | |                        ||||^***               |   ||  |                  |   |              || | | | | |      ||| |   ^***              |  | |   ^***||   |   ^***                   |   |              | ^***|  |   || |||| | | |   | |       |  |||| ||                                                
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      |  |      | |                    | |||   |    |  |                  | |                        ||||                   |   ||  |                  |   |              |********^ |      ||| |                     |  | |   ||  ||   |   |                      |   |              | |   |  |   || |||| | | |   | |       |  |||| ||                                                
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      |  |      | |                    | |^*****    |  |                  | |                        ||||                   |   ||  |                  |   |              |  | | | | |      ||| |                     |  | ^*****  ||   |   |                      |   |              | |   |  |   || ||^***** |   | |       |  |||| ||                                                
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      |  |      | |                    | |||        |  |                  | |                        ||||                   |   ||  |                  |   |              |  | | | | |      ||| |                     |  | |   ||  ||   |   |                      |   |              | |   |  |   ***** | |   |   | |       |  |||| ||                                                
search RasMol script viewer Motif-ligand binding stats  asxmotif ..      |  |      | |                    | |||        |  |                  | |                        ||||                   |   ||  |                  |   |              |  | ***** |      ||| |                     |  | |   ||  ||   |   |                      |   |              | |   |  |   || || | |   |   | |       |  |||| ||                                                
search RasMol script viewer Motif-ligand binding stats  asxturn ..      |  |      | |                    | |||        |  |                  | |                        ||||                   |   ||  |                  |   |              |  | | |   |      *** |                     |  | |   ||  ||   |   |                      |   |              | |   |  |   || || | |   |   | |       |  |||| ||                                                
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****      | |                    ****|        |  |                  | |                        ||||                   |   ||  |                  |   |              |  | | |   |       |  |                     |  | |   ||  ||   |   |                      |   |              | |   |  |   ****| | |   |   | |       |  |||| ||                                                
search RasMol script viewer Motif-ligand binding stats  nest ..                ***                      ***        |  |                  ***                        ****                   |   ||  |                  |   |              |  | | |   |       |  |                     |  | |   ||  ||   |   |                      |   |              ***   |  |    |  | ***   |   ***       |  |||| ||                                                
search RasMol script viewer Motif-ligand binding stats  niche ..                                                    ****                                                                    |   |****                  |   |              ****** |   |       ****                     **** |   ||  ||   |   |                      |   |                    ****    ****       |   | |       ****||****                                                
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                                            |   |                      |   |                     |   |                                   | |   *****|   |   |                      |   |                                       |   | |           ||  ||                                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                            *****                      *****                     *****                                   | |    *****   *****                      *****                                       ***** |           ******                                                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                         ***                                                                                       ***                                                                 

chain D : 50S RIBOSOMAL PROTEIN L7AE
member of: CATH:search3.30.1330.30GENE3D:searchG3DSA_3.30.1330.30HAMAP:searchMF_00326PANTHER:searchPTHR23105PFAM:searchPF01248PRINTS:searchL7ARS6FAMILY/searchRIBOSOMALHS6PROSITE PATTERNS:searchPS01082, SUPERFAMILY:searchSSF55315TIGRFAMS:searchTIGR03677UniProt:searchD0KRE2
sec str:  ..........hhhhhhhhhhhhhhhhhhheeeehhhhhhhhhhh....eeeee....hhhhhhhhhhhhhhhh..eeee.hhhhhhhhh.......eeeeee...hhhhhhhhhhhhhhh....
sequence :  ..ASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKT
seq num:  ..7         17        27        37        47        57        67        77        87        97        107       117         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |                     | | | ||^***||||||||     |  |   |  |     |  | |     | |   |  |||   |     ||                      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |                     | | **^*  ||||||||||     |  |   |  |     |  | |     | |   |  |||   |     ||                      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |                     ^**   ||  ^**|||||||     |  |   |  |     |  | |     ^**   |  |||   |     ||                      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |                           ^***** |||||||     |  |   |  |     |  | |           |  |^*****     ||                      
search RasMol script viewer Motif-ligand binding stats  RIBOSOMAL_L7AE ..|  |                           ||  || |||||||     |  |   |  |     ******************  | |         ||                      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |                           ||  |*****||||     |  |   |  |        | |              | |         ||                      
search RasMol script viewer Motif-ligand binding stats  betabulge ..|  |                           ||  || || ||||     |  |   |  |        | |              | |         **                      
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |                           ||  |*******||     |  |   ****        | |              | |                                 
search RasMol script viewer Motif-ligand binding stats  nest ..|  |                           ||  || |  ****     |  |               ***              ***                                 
search RasMol script viewer Motif-ligand binding stats  niche ..****                           ||  || |   ***     ****                                                                    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                               ||  || ******                                                                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                               ******                                                                                     

chain E : FIBRILLARIN-LIKE RRNA/TRNA 2'-O-METHYLTRANSFERASE
member of: CATH:search3.30.200.20/search3.40.50.150GENE3D:searchG3DSA_3.30.200.20/searchG3DSA_3.40.50.150HAMAP:searchMF_00351PANTHER:searchPTHR10335PFAM:searchPF01269PIRSF:searchPIRSF006540PRINTS:searchFIBRILLARINPROSITE PATTERNS:searchPS00566, SUPERFAMILY:searchSSF53335UniProt:searchP58032
JMol viewer RasMol script viewer  SAH 301E  ..                                                                             * * *  **                 ***                      **                  ****                                                                           
sec str:  ...eeee.....eeeee.....eeeeee............eeee..eeeee.....hhhhhhhhh...........eeeee....hhhhhhhhhhhh...eeeeee.hhhhhhhhhhhhhh...eeeee....hhhhh......eeeeee.....hhhhhhhhhhhhheeeeeeeeeeeehhhhh...hhhhhhhhhhhhhhhh.eeeeeeee.......eeeeeeee.
sequence :  ..ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | | | || |      | | |      |  |  | |              |  |       | |  | |**^*     |||||||  ||       |     | | |   |    |  |  |     | | | |||| ||                      |  ||  |           | ||| |    |  |    |  | ||  | |  |  |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ^** | || |      | ^**      |  |  | |              |  |       | |  | ||  |     |||||||  ||       |     | ^**   |    |  |  |     | | | ^**| ||                      |  ||  |           | ||| |    |  |    |  | ||  | |  |  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     ^*** |      | |        |  |  | |              |  |       | |  | ||  |     |||||||  ||       |     | |     |    |  |  |     | | |  ||^***                      |  ||  |           | ||| |    ^***    ^*** ||  | |  |  |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | |  |      | |        |  |  | |              |  |       | |  | ||  |     ^*****|  ||       |     | |     |    |  |  |     | | |  ||  |                       |  ||  |           | ||| |                 ||  | |  |  |        
search RasMol script viewer Motif-ligand binding stats  FIBRILLARIN ..     | |  |      | |        |  |  | |              |  |       | |  | ||  |     |||||||  ||       ***************    |  |  |     | | |  ||  |                       |  ||  |           | ||| |                 ||  | |  |  |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     | |  |      | |        |  |  | |              |  |       | |  | ||  |     ||||||*****             | |          |  |  |     | | *****  |                       |  ||  |           | ||| |                 ||  | |  |  |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..     | |  |      | |        |  |  | |              |  |       | |  | ||  |     |||||||  |              | |          |  |  |     *** |  ||  |                       |  ||  |           ***|***                 ||  | |  |  |        
search RasMol script viewer Motif-ligand binding stats  betabulge ..     | |  |      | |        |  |  | |              |  |       | |  | ||  |     |||||||  |              | |          |  |  |         |  ||  |                       |  ||  |           |  |                    **  | |  |  |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..     | ****      | |        ****  | |              |  |       | |  | ||  |     |****|****              | |          |  |  |         ****|  |                       |  ||  |           |  |                        | |  |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..     | |         ***        |  |  | |              |  |       ***  | ||  |     *******                 | |          |  |  |             |  |                       |  ||  |           |  |                        | |  |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..     ***                    ****  ***              ****            *******                             ***          *******             ****                       ********           ****                        ***  ****        
search RasMol script viewer Motif-ligand binding stats  stturn ..     ***                                                                                                                                                                                                                           

chain F : FIBRILLARIN-LIKE RRNA/TRNA 2'-O-METHYLTRANSFERASE
member of: CATH:search3.30.200.20/search3.40.50.150GENE3D:searchG3DSA_3.30.200.20/searchG3DSA_3.40.50.150HAMAP:searchMF_00351PANTHER:searchPTHR10335PFAM:searchPF01269PIRSF:searchPIRSF006540PRINTS:searchFIBRILLARINPROSITE PATTERNS:searchPS00566, SUPERFAMILY:searchSSF53335UniProt:searchP58032
JMol viewer RasMol script viewer  SAH 301F  ..                                                                             * * *  **                 ***                      **                  ****                                                                           
sec str:  ...eeee.....eeeee.....eeeeee............eeee..eeeee.....hhhhhhhhh...........eeeee....hhhhhhhhhhhh...eeeeee.hhhhhhhhhhhhhhh..eeeee....hhhhh......eeeeee.....hhhhhhhhhhhhheeeeeeeeeeeehhhhh...hhhhhhhhhhhhhhhh.eeeeeeee.......eeeeeeee.
sequence :  ..ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | | | ||      | ||| |      |  |  | |              |  |    || |||  | |**^*     |||||||  ||       |     | | ||  ||   |  |  |     |  |  | || ||                      |  ||  |           | | | |    |  |    |  | ||  | |  |  |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ^** | ||      | ||^**      |  |  | |              |  |    || |||  | ||  |     |||||||  ||       |     | ^**|  ||   |  |  |     |  |  ^**| ||                      |  ||  |           | | | |    |  |    |  | ||  | |  |  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     ^***      | |||        |  |  | |              |  |    || |||  | ||  |     |||||||  ||       |     | |  |  ||   |  |  |     |  |    |^***                      |  ||  |           | | | |    ^***    ^*** ||  | |  |  |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | |       | |||        |  |  | |              |  |    || |||  | ||  |     ^*****|  ||       |     | |  |  ||   |  |  |     |  |    |  |                       |  ||  |           | | | |                 ||  | |  |  |        
search RasMol script viewer Motif-ligand binding stats  FIBRILLARIN ..     | |       | |||        |  |  | |              |  |    || |||  | ||  |     |||||||  ||       ***************|   |  |  |     |  |    |  |                       |  ||  |           | | | |                 ||  | |  |  |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     | |       | |||        |  |  | |              |  |    || |||  | ||  |     ||||||*****             | |  *****   |  |  |     |  |    |  |                       |  ||  |           | | | |                 ||  | |  |  |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..     | |       | |||        |  |  | |              |  |    || |||  | ||  |     |||||||  |              | |  |  |    |  |  |     |  |    |  |                       |  ||  |           *** ***                 ||  | |  |  |        
search RasMol script viewer Motif-ligand binding stats  betabulge ..     | |       | |||        |  |  | |              |  |    || |||  | ||  |     |||||||  |              | |  |  |    |  |  |     |  |    |  |                       |  ||  |                                   **  | |  |  |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..     | |       ****|        ****  | |              |  |    |****|  | ||  |     |****|****              | |  ****    |  |  |     ****    |  |                       |  ||  |                                       | |  |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..     | |         ***        |  |  | |              |  |    |  ***  | ||  |     *******                 | |          |  |  |             |  |                       |  ||  |                                       | |  |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..     ***                    ****  ***              ****    |    |  *******                             ***          *******             ****                       ********                                       ***  ****        
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..     | |                                                   ******                                                                                                                                                                  
search RasMol script viewer Motif-ligand binding stats  stturn ..     ***                                                                                                                                                                                                                           

chain G : C/D GUIDE RNA
JMol viewer RasMol script viewer  SAH 301E  ..                        *          
JMol viewer RasMol script viewer  U 9H  ..                        |      **  
sec str:  .....................................
sequence :  ..GGGAGUCUUGUGAUGAAACACUCAUGGUCUGAAGA
seq num:  ..1         11        21        31   

chain H : C/D GUIDE RNA
JMol viewer RasMol script viewer  SAH 301F  ..               *               
JMol viewer RasMol script viewer  U 9H  ..* **           |               
sec str:  .................................
sequence :  ..GUGAUGAAACACUCAUGGUCUGAAGACUCCC
seq num:  ..10        20        30         

chain I : RNA (5'-R(*CP*CP*AP*UP*GP*AP*GP*UP*GP*U)-3')
JMol viewer RasMol script viewer  SAH 301E  ..    *     
sec str:  ............
sequence :  ..CCAUGAGUGU
seq num:  ..1         

chain J : RNA (5'-R(*CP*CP*AP*UP*GP*AP*GP*UP*GP*U)-3')
JMol viewer RasMol script viewer  SAH 301F  ..          
sec str:  ............
sequence :  ..CCAUGAGUGU
seq num:  ..1         

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain K : PRE MRNA SPLICING PROTEIN
member of: PANTHER:searchPTHR10894PFAM:searchPF01798/searchPF08060PROSITE PROFILES:searchPS51358, SMART:searchSM00931SUPERFAMILY:searchSSF89124UniProt:searchQ97ZH3
sec str:  ...eeeeee..eeeee.....eeeeee...hhhhhhhhhhhhh....hhhhhhhhhhh...eeee....hhhhhhh...eeee...hhhhhhhhhh..hhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhh...hhhhhhhhhhhh......hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh.
sequence :  ..KIYLIEHVIGAVAYDENGNIVDYITNPRDLGKITEELLNNEKGIPFSATVELLKKVNPQEVVVENEAEVPKLQALGYRVSYEPYSKVSRIFRESLPKVAIDIKFASNEEDYYNFLHELSLEYTRRKLRSAAQKRDLLAIQAVRAMDDIDKTINLFSERLREWYSIHFPELDKLIEDHEEYATIVSRFGDRGFLTIDSLKELGFNEQRINRILDAAKKSIGADISEDDLSAMRMIANTILDLYNIRRNLNNYLEGVMKEVAPNVTALVGPALGARLLSIAGSLDELAKMPASTIQVLGAEKALFRALRSGGRPPKHGIIFQYPAIHTSPRWQRGKIARALAAKLAIAARVDAFSGRFIGDQLNEQLKKRIDEIKEK
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      |  |      | |                    | |||   |                          | |                        |||||  |             | |   ||  |                  |   | |            || | | | | |      ||| |   ||||| |           |  | |   || |||   |   |  |                   | ^***||             |  ||  |   || |||| | | |   | |       |  |||| || |                       | |                    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      |  |      | |                    | |||   |                          | |                        |||||  |             ^**   ||  |                  |   ^**            || | | | | |      ||| |   ^**|| |           |  | |   || |||   |   |  |                   |  || ||             |  ||  |   || |||| | | |   | |       |  |||| |^**                       ^**                    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      |  |      | |                    | |||   |                          | |                        ||||^***               |   ||  |                  |   |              || | | | | |      ||| |   ^***| |           |  | |   ^***||   |   ^***                   |  || ||             ^***|  |   || |||| | | |   | |       |  |||| ||                                                
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      |  |      | |                    | |||   |                          | |                        ||||                   |   ||  |                  |   |              |********^ |      ||| |    |  | |           |  | |   ||  ||   |   |                      |  || ||                 |  |   || |||| | | |   | |       |  |||| ||                                                
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      |  |      | |                    | |^*****                          | |                        ||||                   |   ||  |                  |   |              |  | | | | |      ||| |    |  | |           |  | ^*****  ||   |   |                      |  || ||                 |  |   || ||^***** |   | |       |  |||| ||                                                
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      |  |      | |                    | |||                              | |                        ||||                   |   ||  |                  |   |              |  | | | | |      ||| |    |  | |           |  | |   ||  ||   |   |                      |  *****                 |  |   ***** | |   |   | |       |  |||| ||                                                
search RasMol script viewer Motif-ligand binding stats  asxmotif ..      |  |      | |                    | |||                              | |                        ||||                   |   ||  |                  |   |              |  | ***** |      ||| |    |  | |           |  | |   ||  ||   |   |                      |  || |                  |  |   || || | |   |   | |       |  |||| ||                                                
search RasMol script viewer Motif-ligand binding stats  asxturn ..      |  |      | |                    | |||                              | |                        ||||                   |   ||  |                  |   |              |  | | |   |      *** |    |  | |           |  | |   ||  ||   |   |                      |  || |                  |  |   || || | |   |   | |       |  |||| ||                                                
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****      | |                    ****|                              | |                        ||||                   |   ||  |                  |   |              |  | | |   |       |  |    **** |           |  | |   ||  ||   |   |                      |  ****                  |  |   ****| | |   |   | |       |  **** ||                                                
search RasMol script viewer Motif-ligand binding stats  nest ..                ***                      ***                              ***                        ****                   |   ||  |                  |   |              |  | | |   |       |  |       ***           |  | |   ||  ||   |   |                      |   |                    |  |    |  | ***   |   ***       |  |||| ||                                                
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                                                                            |   |****                  |   |              ****** |   |       ****                     **** |   ||  ||   |   |                      |   |                    ****    ****       |   |         ****||****                                                
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                                            |   |                      |   |                     |   |                                   | |   *****|   |   |                      |   |                                       |   |             ||  ||                                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                            *****                      *****                     *****                                   | |    *****   *****                      *****                                       *****             ******                                                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                         ***                                                                                                                                                           

chain L : 50S RIBOSOMAL PROTEIN L7AE
member of: CATH:search3.30.1330.30GENE3D:searchG3DSA_3.30.1330.30HAMAP:searchMF_00326PANTHER:searchPTHR23105PFAM:searchPF01248PRINTS:searchL7ARS6FAMILY/searchRIBOSOMALHS6PROSITE PATTERNS:searchPS01082, SUPERFAMILY:searchSSF55315TIGRFAMS:searchTIGR03677UniProt:searchD0KRE2
sec str:  ..........hhhhhhhhhhhhhhhhhhheeeehhhhhhhhhhh....eeeee....hhhhhhhhhhhhhhh...eeee.hhhhhhhhh.......eeeeee...hhhhhhhhhhhhhhh....
sequence :  ..ASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKT
seq num:  ..7         17        27        37        47        57        67        77        87        97        107       117         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |                 |   | | | ||^***||| ||||     |  |            |  | |     | |   |  |||   |     ||                      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |                 |   | | **^*  ||||| ||||     |  |            |  | |     | |   |  |||   |     ||                      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |                 |   ^**   ||  ^**|| ||||     |  |            |  | |     ^**   |  |||   |     ||                      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |                 |   |     ^***** || ||||     |  |            |  | |           |  |^*****     ||                      
search RasMol script viewer Motif-ligand binding stats  RIBOSOMAL_L7AE ..|  |                 |   |     ||  || || ||||     |  |            ******************  | |         ||                      
search RasMol script viewer Motif-ligand binding stats  betabulge ..|  |                 |   |     ||  || || ||||     |  |               | |              | |         **                      
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |                 |   |     ||  || |****||     |  |               | |              | |                                 
search RasMol script viewer Motif-ligand binding stats  nest ..|  |                 |   |     ||  || |  ****     |  |               ***              ***                                 
search RasMol script viewer Motif-ligand binding stats  niche ..****                 |   |     ||  || |   ***     ****                                                                    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                     |   |     ||  || ******                                                                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                     *****     ******                                                                                     

chain M : FIBRILLARIN-LIKE RRNA/TRNA 2'-O-METHYLTRANSFERASE
member of: CATH:search3.30.200.20/search3.40.50.150GENE3D:searchG3DSA_3.30.200.20/searchG3DSA_3.40.50.150HAMAP:searchMF_00351PANTHER:searchPTHR10335PFAM:searchPF01269PIRSF:searchPIRSF006540PRINTS:searchFIBRILLARINPROSITE PATTERNS:searchPS00566, SUPERFAMILY:searchSSF53335UniProt:searchP58032
JMol viewer RasMol script viewer  SAH 301M  ..                                                                             * * *  **                 ***                      **                  ****                                                                           
sec str:  ...eeee.....eeeee.....eeeeee............eeee..eeeee.....hhhhhhhhh...........eeeee....hhhhhhhhhhhh...eeeeee.hhhhhhhhhhhhhh...eeeee....hhhhh......eeeeee.....hhhhhhhhhhhhheeeeeeeeeeeehhhhh...hhhhhhhhhhhhhhhh.eeeeeeee.......eeeeeeee.
sequence :  ..ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | | | ||        | | |      |  |  | |              |  |    || |||  | |**^*     |||||||           |     | | |   |    |  |  |           | || ||                      |  ||  |           | ||| |    |  |    |  | ||       |  |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ^** | ||        | ^**      |  |  | |              |  |    || |||  | ||  |     |||||||           |     | ^**   |    |  |  |           ^**| ||                      |  ||  |           | ||| |    |  |    |  | ||       |  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     ^***        | |        |  |  | |              |  |    || |||  | ||  |     |||||||           |     | |     |    |  |  |             |^***                      |  ||  |           | ||| |    ^***    ^*** ||       |  |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | |         | |        |  |  | |              |  |    || |||  | ||  |     ^*****|           |     | |     |    |  |  |             |  |                       |  ||  |           | ||| |                 ||       |  |        
search RasMol script viewer Motif-ligand binding stats  FIBRILLARIN ..     | |         | |        |  |  | |              |  |    || |||  | ||  |     |||||||           ***************    |  |  |             |  |                       |  ||  |           | ||| |                 ||       |  |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..     | |         | |        |  |  | |              |  |    || |||  | ||  |     |||||||                 | |          |  |  |             |  |                       |  ||  |           ***|***                 ||       |  |        
search RasMol script viewer Motif-ligand binding stats  betabulge ..     | |         | |        |  |  | |              |  |    || |||  | ||  |     |||||||                 | |          |  |  |             |  |                       |  ||  |           |  |                    **       |  |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..     | |         | |        ****  | |              |  |    |****|  | ||  |     |****||                 | |          |  |  |             |  |                       |  ||  |           |  |                             |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..     | |         ***        |  |  | |              |  |    |  ***  | ||  |     *******                 | |          |  |  |             |  |                       |  ||  |           |  |                             |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..     ***                    ****  ***              ****    |    |  *******                             ***          *******             ****                       ********           ****                             ****        
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                           ******                                                                                                                                                                  

chain N : C/D GUIDE RNA
JMol viewer RasMol script viewer  SAH 301M  ..                  *           
JMol viewer RasMol script viewer  U 6N  ..*                 |         * 
sec str:  ................................
sequence :  ..CUUGUGAUGAAACACUCAUGGUCUGAAGAC
seq num:  ..7         17        27        

chain O : RNA (5'-R(*CP*CP*AP*UP*GP*AP*GP*UP*GP*U)-3')
JMol viewer RasMol script viewer  SAH 301M  ..          
sec str:  ............
sequence :  ..CCAUGAGUGU
seq num:  ..1         

   New search    3pla:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors