triangle PDBeMotif: 3pey  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.6.4.13
Classification hydrolase/rna    | release date: Wed, Oct 27, 2010
Title s. cerevisiae dbp5 bound to rna and adp bef3
Authors B.MONTPETIT, J.M.BERGER, K, K.J.HELMKE, M.A.SEELIGER, N.D.THOMSEN
Method X-RAY DIFFRACTION (resolution: 1.40Å)
PDBe Citation   
Small molecules:    search U U binding statistics U   search MG MG binding statistics MG   search ADP ADP binding statistics ADP   search BEF BEF binding statistics BEF   search NO3 NO3 binding statistics NO3   search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GAMAKSFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAIC
LAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQ
QGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKNEADKFDVLTELYGL
MTIGSSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDL
PTLANGQADPATYIHRIGRTGRFGRKGVAISFVHDKNSFNILSAIQKYFGDIEMTRVPTDDWDEVEKIVKKVLKD
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ATP-DEPENDENT RNA HELICASE DBP5
member of: GENE3D:searchG3DSA_3.40.50.300PANTHER:searchPTHR24031/searchPTHR24031_SF208PFAM:searchPF00270/searchPF00271PROSITE PATTERNS:searchPS00039, PROSITE PROFILES:searchPS51192/searchPS51194/searchPS51195, SMART:searchSM00487/searchSM00490SUPERFAMILY:searchSSF52540UniProt:searchP20449
JMol viewer RasMol script viewer  NO3 1009B  ..                                                                                                                                                                  *                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  GOL 1008A  ..                                                                                                                                      **                          |                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  NO3 1007A  ..                                                                                                                                     *||                          |  *                                                                                                                                                                                                                                 
JMol viewer RasMol script viewer  NO3 1006A  ..                                         *                                                                                           |||                          |  |                               *                                                                                                                                                                                                 
JMol viewer RasMol script viewer  NO3 1005A  ..                                         |                                                                                           |||                          | ***                         *  |                                                                                                                                                                                                 
JMol viewer RasMol script viewer  MG 1004A  ..                                         |                                                                                           |||                          | || ||                         |  |                                                                                                                                                                                                 
JMol viewer RasMol script viewer  MG 1003A  ..                                         |                                                                                           |||                          | || ||    *                    |  |                                                                                                                                                                                                 
JMol viewer RasMol script viewer  BEF 1002A  ..                                         |       *   *                                                                               |||             *            | || ||    |                    |  |                                                                                                        *                                *  *                                                    
JMol viewer RasMol script viewer  MG 1001A  ..                                         |       |   |                                                                               |||             |            | || ||    |                    |  |                                                                                                        |                                |  |                                                    
JMol viewer RasMol script viewer  ADP 1000A  ..                     * *    *            |       |*****                                                                              |||             |            | || ||    |                    |  |                                                                                                        | *                              |  **                                                   
JMol viewer RasMol script viewer  U 6B  ..                     | |    |            |       ||||||                                                    *                         |||             |            | || ||    |                    |  |                                                                                                        | |                              |  ||                                                   
JMol viewer RasMol script viewer  U 5B  ..                     | |    |            |       ||||||                                                    *                * **  *  |||             |            | || ||    |                    |  |                                                                                                        | |                              |  ||                                                   
JMol viewer RasMol script viewer  U 4B  ..                     | |    |            |       ||||||                        ***                         |                ***|  |  |||             |        **  * || ||    |                    |  |                                                                                *                       | |                              |  ||                                                   
JMol viewer RasMol script viewer  U 3B  ..                     | |    |            |       ||||||                        *||                         |                ||||  |  |||             |       *|*  | || ||    |                    |  |                                                   *                    **      |                 * *   | |                              |  ||                                                   
JMol viewer RasMol script viewer  U 2B  ..                     | |    |            |       ||||||                        |||                         |                ||||  |  |||             |      **||  | || ||    |                    |  |                                                 ***                    ||      |                 **|   | |                              |  ||                                                   
JMol viewer RasMol script viewer  U 1B  ..                     | |    |            |       ||||||                        |||                         |                ||||  |  |||             |      ||||  | || ||    |                    |  |                                                 **|                    ||      |                 |||   | |                              |  ||                                                   
sec str:  ...........hhhhhhhhhhh.....hhhhhhhhhhhhh.....eeee.....hhhhhhhhhhhhhh........eeee..hhhhhhhhhhhhhhhh......eeee..............eeeehhhhhhhhhhh.........eeeeehhhhhhhh.hhhhhhhhhhhh.....eeeeee...hhhhhhhhhhhh...eee..hhhhh....eeeeeee..hhhhhhhhhhhhhh.....eeeee..hhhhhhhhhhhhhhh....eee....hhhhhhhhhhhhhh....eeee.hhhh.......eeeeee...........hhhhhhhhhh........eeeeeee.hhhhhhhhhhhhhhh.....ee....hhhhhhhhhhhhhh
sequence :  ..AKSFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKNEADKFDVLTELYGLMTIGSSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFVHDKNSFNILSAIQKYFGDIEMTRVPTDDWDEVEKIVKKVLK
seq num:  ..91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | ||| |        | |||   |   |    |  |            |^**|||   | |  || |||                        |  | |       | ||  | | |    |   || | | |||| |  |   |  | | || |         || |||  |     | |  |    |  |||  |     | || ||  |        |   |      || || |        ^** |         | |     |  |             ||||     ||| || | |  |    | |   | |||         | |^**|  ||    |             || |||                       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ^***| |        | |||   |   |    |  |            |||||||   | |  || |||                        |  | |       | ||  | | |    |   ^*** | |||| |  |   |  | | || |         || |||  |     | ^***    |  |||  |     | || ||  |        |   |      || || |        |   |         | |     |  |             ||||     ||| || | |  |    | |   | |||         | || ||  ||    |             || |||                       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | | | |        | |||   |   |    |  |            ^*****|   | |  || |||                        |  | |       | ||  | | |    ^*****   | |||| |  |   |  | | || |         || |||  |     | |       |  |||  |     | || ||  |        |   |      || || |        |   |         | |     |  |             ||||     ||| || | |  |    | |   | |||         | || ||  |^*****             || |||                       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  | | | |        | |||   |   |    |  |            ||||| |   | |  || |||                        |  | |       | ||  | | |             | |||| |  |   |  | | || |         || |||  |     | |       |  |||  |     | || ||  |        |   |      || || |        |   |         | |     |  |             ||||     ||| || | |  |    | |   | |||         | || |^***                   || |||                       
search RasMol script viewer Motif-ligand binding stats  DEAD_ATP_HELICASE ..  | | | |        | |||   |   |    |  |            ||||| |   | |  || |||                        |  | |       | ||  | | |             | |||| |  |   ********* |         || |||  |     | |       |  |||  |     | || ||  |        |   |      || || |        |   |         | |     |  |             ||||     ||| || | |  |    | |   | |||         | || |                       || |||                       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | | | |        | |||   |   |    |  |            ||||| |   | |  || |||                        |  | |       | ||  | | |             | |||| |  |      | | |  |         || |||  |     | |       *****|  |     | || ||  |        |   |      || || |        |   |         | |     |  |             ||||     ||| || | |  |    | |   | |||         | || |                       || |||                       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  | | | |        | |||   |   |    |  |            ||||| |   | |  |*****                        |  | |       | ||  | | |             | |||| |  |      | | |  |         || |||  |     | |       |  | |  |     | || ||  |        *****      || || |        |   |         | |     |  |             ||||     ||| || | |  |    | |   | |||         | || |                       || |||                       
search RasMol script viewer Motif-ligand binding stats  asxturn ..  | | | |        | |||   |   |    |  |            ||||| |   | |  |***|                         |  | |       | ||  | | |             | |||| |  |      | | |  |         || |||  |     | |       |  | |  |     | || ||  |                   || || |        |   |         | |     |  |             ||||     ||| || | |  |    | |   | |||         | || |                       || |||                       
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  | | | |        | |||   |   |    |  |            ||||| |   | |  ||  |                         |  | |       | ||  | | |             | |||| |  |      | | |  |         || |||  |     | |       |  | |  |     | || ||  |                   || || |        |   |         | |     |  |             ||||     ||| || | |  |    | |   *****         | || |                       || |||                       
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | | | |        ****|   |   |    |  |            ||||| |   | |  |****                         |  | |       | ||  | | |             ****|| |  |      | | |  |         *****|  |     | |       **** |  |     **** ||  |                   ***** |        |   |         | |     |  |             ||||     |****| | |  |    | |   ****|         | || |                       |****|                       
search RasMol script viewer Motif-ligand binding stats  nest ..  | | ***          ***   |   |    |  |            ***** |   | |  ||  |                         |  | |       ***|  | | |               **** |  |      *** |  |          |  ||  |     | |            |  |       |  ||  |                       | |        |   |         ***     |  |             ****     | | || | |  |    | |     ***         | || |                       |  ***                       
search RasMol script viewer Motif-ligand binding stats  niche ..  | |                    |   |    ****                  |   | ********                         ******          **** ***                    ****          ****          ********     | |            ****       ********                       ***        |   |                 ****                      | ****** ****    ***                 ******                       |    |                       
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..  | |                    |   |                          |   |                                     | |                                                                               | |                                                                 |   |                                           | |                                                               ******                       
search RasMol script viewer Motif-ligand binding stats  stmotif ..  | |                    *****                          |   |                                     | |                                                                               | |                                                                 *****                                           | |                                                                                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..  | |                                                   *****                                     | |                                                                               | |                                                                                                                 | |                                                                                            
search RasMol script viewer Motif-ligand binding stats  stturn ..  ***                                                                                             ***                                                                               ***                                                                                                                 ***                                                                                            

   New search    3pey:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors