triangle PDBeMotif: 3pep  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.4.23.1
Classification hydrolase (acid proteinase)    | release date: Tue, Oct 24, 1989
Title revised 2.3 angstroms structure of porcine pepsin. evidence for a flexible subdomain
Authors C.ABAD-ZAPATERO, J.W.ERICKSON
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Small molecules:    search EOH EOH binding statistics EOH
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
IGDEPLENYLDTEYFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACSDHNQFNPDDSSTFEATSQELSITYGTGSM
TGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISASGATPVFDNLWDQGLVSQDLFSVYLSSNDD
SGSVVLLGGIDSSYYTGSLNWVPVSVEGYWQITLDSITMDGETIACSGGCQAIVDTGTSLLTGPTSAIANIQSDIGASEN
SDGEMVISCSSIDSLPDIVFTIDGVQYPLSPSAYILQDDDSCTSGFEGMDVPTSSGELWILGDVFIRQYYTVFDRANNKV
GLAPVA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PEPSIN
member of: CATH:search2.40.70.10GENE3D:searchG3DSA_2.40.70.10PANTHER:searchPTHR13683/searchPTHR13683_SF239PFAM:searchPF00026PRINTS:searchPEPSINPROSITE PATTERNS:searchPS00141, SUPERFAMILY:searchSSF50630UniProt:searchP00791
JMol viewer RasMol script viewer  EOH 902A  ..                                                                         *                                                                                                                                                                                                                                                            
JMol viewer RasMol script viewer  EOH 901A  ..            **               *                                           |                                                                                                                                             *                                                                                      *                       
sec str:  ...eeee.........eeeeee....eeeeeeee.....eeee......hhhhh.....hhh....eeeeeeeeee....eeeeeeeeeeeee..eeeeeeeeeeeee...hhhhh....eeee...hhh.hhh...hhhhhhh.......eeeee.........eeee....hhh.....eeee.......eeeeeeee...ee......eeeee......eee.hhhhhhhhhhh..eee....eee.hhhhhhh..eeeee..eeeee.hhhheee....eee.eee.........eeee.hhhh..eeeeee....eeeeee..
sequence :  ..IGDEPLENYLDTEYFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACSDHNQFNPDDSSTFEATSQELSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISASGATPVFDNLWDQGLVSQDLFSVYLSSNDDSGSVVLLGGIDSSYYTGSLNWVPVSVEGYWQITLDSITMDGETIACSGGCQAIVDTGTSLLTGPTSAIANIQSDIGASENSDGEMVISCSSIDSLPDIVFTIDGVQYPLSPSAYILQDDDSCTSGFEGMDVPTSSGELWILGDVFIRQYYTVFDRANNKVGLAPVA
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | |||               |  || |    | |  | || || |   ||| |^*** ^***    |  |    |         |    |   | ^***  | |||| |        |  |  |    |  || ||||         ^***|  |    |  |||||                       |  |     |   || || | |  |           |||  |^***    |^***^***              |  |        ^***      ^***    |  ||  | ^***  | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        | |||               |  || |    | |  | || || |   ||| |  |  | |     |  ^*****         ^*****   ^*****  | |||| |        |  |  |    |  || ||||             |  |    ^*****||                       |  |     ^***** || | |  |           |^*****|||    |||||||                |  |                          |  ||  |       | |       
search RasMol script viewer Motif-ligand binding stats  ASP_PROTEASE ..        | |||               ***^******** |  | || || |   ||| |  |  | |     |                             ||   | |||| |        |  |  |    |  || ||||             |  |       || ||                       |  |         ***^********           | |  | |||    |||||||                |  |                          |  ||  |       | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | |||                  || |      |  | || || |   ||| |  |  | |     |                             ||   *****| |        |  |  |    ***** ||||             |  |       || ||                       |  |            || | |              | |  | |||    |*****|                |  |                          *****  |       | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..        | |||                  || |      |  | || || |   ||| |  |  | |     |                             ||   | || | |        |  |  |    |  || ||||             |  |       || ||                       |  |            || | |              | |  *****    |||||||                |  |                          |  ||  |       | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..        | |||                  || |      |  | || || |   *** |  |  | |     |                             ||   | || | |        |  |  |    |  || ||||             |  |       || ||                       |  |            || | |              | |  ***||    |||||||                |  |                          |  ||  |       | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..        | |||                  || |      |  | || || |    |  |  |  | |     |                             **   | || | |        |  |  |    |  || ||||             |  |       || ||                       |  |            || | |              | |  | |||    |||||||                |  |                          |  ||  |       | |       
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..        *****                  || |      |  | || || |    |  |  |  | |     |                                  | || | |        |  |  |    |  || ||||             |  |       || ||                       |  |            || | |              | |  *****    |||||||                |  |                          |  ||  |       | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ****|                  || |      |  | |**** |    |  |  |  | |     |                                  **** | |        *******    ********||             |  |       ****|                       |  |            || | |              | |  ****|    ******|                |  |                          ********       | |       
search RasMol script viewer Motif-ligand binding stats  nest ..          ***                  || |      |  | |  |  |    |  |  |  | |     |                                    |  | |        |  |          |  ****             |  |        |  |                       |  |            || | |              ***    ***       |  |                |  |                              |  |       ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                               ****      ******  ****    *******  ***     |                                    ******        ****          |    |              ****        ****                       ****            ******                               ****                ****                              ****                 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                               || |                               | |     |                                                                ******                                                                     || |                                                                                                            
search RasMol script viewer Motif-ligand binding stats  stturn ..                               || |                               ***     |                                                                                                                                           || |                                                                                                            
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                               ** *                                       *                                                                                                                                           ** *                                                                                                            

   New search    3pep:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML