triangle PDBeMotif: 3pe4  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.4.1.
Classification transferase    | release date: Mon, Oct 25, 2010
Title structure of human o-glcnac transferase and its complex with substrate
Authors J.JIANG, M.B.LAZARUS, P.SLIZ, S.WALKER, Y.NAM
Method X-RAY DIFFRACTION (resolution: 1.95Å)
PDBe Citation   
Small molecules:    search UDP UDP binding statistics UDP   search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,C sequence:
GPGSCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAY
SNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCD
WTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRV
GYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVN
MNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKK
AVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQIT
INGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRF
PAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAAS
QLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
PVE
Chains B,D sequence:
YPGGSTPVSSANMM
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYLTRANSFERASE 110 KDA SUBUNIT;
member of: GENE3D:searchG3DSA_1.25.40.10PANTHER:searchPTHR23083/searchPTHR23083_SF369PFAM:searchPF00515/searchPF13844PROSITE PROFILES:searchPS50005/searchPS50293, SMART:searchSM00028SUPERFAMILY:searchSSF48452UniProt:searchO15294
JMol viewer RasMol script viewer  SO4 1B  ..                                                                                                                                                                                                                                                                                                                               **                                                                               ..SO4 ..                            ..                                                                                                                                                                                                                                                                           
JMol viewer RasMol script viewer  SO4 5A  ..                                                  ****                                                                                                                                                                                                                                                                         ||                                                                               ..SO4 ..                            ..                                                                                                                                                                                                                                                                           
JMol viewer RasMol script viewer  UDP 1212A  ..                                                  ||||                                                                                                                                                                                              *                                                                          ||                                                                               ..UDP ..                            ..                                                                                *                       * *                          ** *  *  *               ***  *                                                                                                       
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh......hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..................eeeeeee.....hhhhhhhhhhhhhh....eeeeeee......hhhhhhhhhhh.eeee.hhh.hhhhhhhhhhhh...eeee.........hhhhhh....eeee..............eeee.....hhhhhhhh..eeee........hhhhhhhhhh..eeee..... .......eeee..hhhhhhhh....eee......eeeee.hhhhhhhhhhhhhh..eeee..eeeee..hhhhhhhhhhh.......eeeee.hhhh.....eeee...hhhhhhhhhhhhhhhhhhhh..eeeeeee.hhhhhhhhhhhhhhh..hhh.eeeee..hhhhhhhhhhhh.eee.......hhhhhhhhhh...ee.....hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.........
sequence :  ..THADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFK... ..IYDNRIVLNGIDLKAFLDSLPDVKIVKM..LNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
seq num:  ..315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535       545       555       565       575       585       595       605       615       625       635       645       655       665       675       685       695       705       ... ..719       729       739     ..762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962       972       982       992       1002      1012      1022   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|| |         | |||                               | |                |  |       ^**||||  | |  ||  |  |  |    |   || | |||      ^**     | |              | | || |               | | | ||  ||  | ||   |                 | |           | |       | |||    |     || || |  |       | ||||      |  |    ||| | |          | |    | |  |  |    |  |       | |  |||||| |    || | || ||| ||^**      | |         |  |       ..PS00005..         |  |  || || ||     ..      | ||  |       | |    |  |    |   || |    ||||       ^**  ||||  |    | | |  |          |  ||          || ||      || ||| | ||             || ||             |  ||| |||      | |      |   | | ||  |  |   |    ||| || ||         ||| |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***         | |||                               | |                ^***       ^***|||  | |  ||  |  |  |    |   || | |||              | |              | | ^***               | | | ||  ||  | ||   |                 | |           | |       | |||    |     || || |  |       ^***||      |  |    ||| | |          | |    | |  |  |    |  |       | |  |||||| |    ^*** ^***|| || |       | |         |  |       ..PS00006..         |  |  || ^***|     ..      | |^***       | |    |  |    |   || |    ^***         |  ||||  |    | | |  |          |  ||          || ||      || ||| | ||             || ||             ^***|| |||      | |      |   | | ||  |  |   |    ||| ^***|         ||| |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |           | |||                               | |                            || |||  | |  ||  |  |  |    |   || | |||              | |              | | || |               | | | ||  ||  | ||   |                 | |           | |       | |||    |     || || |  |         ||||      |  |    ||| | |          | |    | |  |  |    |  |       | |  |||||| |     | |  |  || || |       | |         |  |       ..PS00007..         |  |  || ||  |     ..      | |           | |    |  |    |   || |    ||||         |  ||||  |    | | |  |          |  ||          || ||      || ||| | ||             || ||                 || |||      | |      |   | | ||  |  |   |    |*******^         ||| |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..**           | |||                               | |                            || |||  ^*****|  |  |  |    |   || | |||              | |              | | || |               | | | ||  ||  | ||   |                 | |           | |       | ||^*****     || || |  |         ||||      |  |    ||| | |          | |    | |  |  |    |  |       | |  ^***** |     | |  |  || || |       | |         |  |       ..PS00008..         |  |  || ||  |     ..      | |           | |    |  |    ^***** |    ||||         |  ||||  |    | | |  |          |  ||          || ||      || |^*****|             || ||                 || |||      | |      |   | | ||  |  |   |    | | ||            ||| |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..             | |||                               | |                            || |||    |   |  |  |  |    |   || | |||              | |              | | || |               | | | |*****  | ||   |                 | |           | |       | ||           || || |  |         ||||      |  |    ||| | |          | |    | |  |  |    |  |       | |   ||||  |     | |  |  || || |       | |         |  |       ..alphabetamotif..         |  |  || ||  |     ..      | |           | |    |  |        |  |    ||||         *****||  |    | | |  |          *****          || ||      || ||| |  |             || ||                 || |||      | |      |   | | ||  |  |   |    | | ||            ||| |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..             | |||                               | |                            || |||    |   |  |  |  |    |   || | |||              | |              | | || |               | | | ||  ||  | ||   |                 | |           | |       | ||           || || |  |         ||||      |  |    ||| | |          | |    | |  |  |    |  |       | |   ||||  |     | |  |  || || |       | |         |  |       ..asxmotif..         |  |  || ||  |     ..      | |           | |    |  |        |  |    ||||         |  | ||  |    | | |  |          |  |           || ||      || ||| |  |             || ||                 || |||      | |      |   | | ||  |  *****    | | ||            ||| |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  asxturn ..             | |||                               | |                            || |||    |   |  |  |  |    |   || | |||              | |              | ***| |               | | | ||  ||  | ||   |                 | |           | |       | ||           || || |  |         ***|      |  |    *** | |          | |    ***  |  |    |  |       | |   ||||  |     ***  |  || || |       | |         |  |       ..asxturn..         |  |  || ||  |     ..      | |           | |    |  |        |  |    ||||         |  | ||  |    | | |  |          |  |           || ||      || ||| |  |             || ||                 || |||      | |      |   | | ||  |           | | ||            ||| |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  betaturn ..             ****|                               | |                            |****|    |   |  |  |  |    |   || ****|              | |              | | || |               | | | |****|  | ||   |                 | |           | |       | ||           ****| |  |          | |      |  |     **** |          | |         ****    ****       | |   ||||  |          *******| |       | |         |  |       ..betaturn..         ****  *****  |     ..      | |           | |    ****        |  |    ||||         **** ||  |    | | |  |          ****           *****      |****| |  |             ****|                 |****|      | |      |   | | ||  |           | | ||            ||| |||| |                 |****|       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..               | |                               | |                            |  | |    |   |  |  |  |    |   ||   | |              | |              | | || |               | | | |    |  ***|   |                 | |           | |       | ||            |  | |  |          | |      |  |        | |          | |         |  |               ***   ||||  |              |  | |       | |         |  |       ..gammaturn..                |  |  |     ..      ***           | |                |  |    ||||            | ||  |    | | |  |                                    |  | | |  |              |  |                 |  | |      | |      |   | | ||  |           | | ||            ||| |||| |                 |  | |       
search RasMol script viewer Motif-ligand binding stats  nest ..               ***                               ***                            |  ***    |   |  |  |  |    |   ||   ***              | |              *** |***               *** | |    |  |  |   |                 ***           ***       | ||            |  | |  |          ***      |  |        | |          ***         |  |                     |***  |              |  | |       | |         |  |       ..nest..                |  |  |     ..                    ***                |  |    ****            ***|  |    | | |  |                                    |  *** |  |              |  |                 |  ***      | |      |   | ***|  |           | | ||            ||| |||| |                 |  ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                                |    |    |   |  *******    |   ||   |                ***                ***                      ***    ****  |   |                                         ****            **** ****                   ****        ***                      ****                     |||****              ******       ***         ****       ..niche..                *******     ..                                       ****                       ****    *** ****                                    |    | ****              ****                 |    |      ***      |   |    ****           | ****            ||********                 |    |       
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                ******    |   |             |   ||   |                                                                         |   |                                         | |                                                                                                       ||||                              | |                    ..schellmannloop..                            ..                                                                                                                      ******                                        ******               |   |                   |   |             ||  || |                   ******       
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                          |   |             |   ||   |                                                                         *****                                         | |                                                                                                       ||||                              | |                    ..stmotif..                            ..                                                                                                                                                                                         |   |                   |   |             ||  || |                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                          *****             **********                                                                                                                       | |                                                                                                       ||||                              | |                    ..ststaple..                            ..                                                                                                                                                                                         *****                   *****             ****** |                                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                                             ***                                                                                                       ****                              ***                    ..stturn..                            ..                                                                                                                                                                                                                                        ***                                

chain B : CASEIN KINASE II SUBUNIT ALPHA
member of: PANTHER:searchPTHR24054/searchPTHR24054_SF28UniProt:searchP68400
JMol viewer RasMol script viewer  SO4 1B  ..           ** 
JMol viewer RasMol script viewer  UDP 1212A  ..     * **  || 
sec str:  ................
sequence :  ..YPGGSTPVSSANMM
seq num:  ..13        23  
search RasMol script viewer Motif-ligand binding stats  betaturn ..****          

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYLTRANSFERASE 110 KDA SUBUNIT;
member of: GENE3D:searchG3DSA_1.25.40.10PANTHER:searchPTHR23083/searchPTHR23083_SF369PFAM:searchPF00515/searchPF13844PROSITE PROFILES:searchPS50005/searchPS50293, SMART:searchSM00028SUPERFAMILY:searchSSF48452UniProt:searchO15294
JMol viewer RasMol script viewer  SO4 3D  ..                                                                                                                                                                                                                                                                                                           *                                                                               ..SO4 ..                            ..                                                                                                                                                                                                                                                                           
JMol viewer RasMol script viewer  UDP 1212C  ..                                                                                                                                                                                                                               *                                                                           |                                                                               ..UDP ..                            ..                                                                             *  *                       * *                          ** *  *  *               ***  *                                                                                                       
sec str:  ..hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh......hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..................eeeeeee.....hhhhhhhhhhhhhh....eeeeeee......hhhhhhhhhhh.eeee.hhh.hhhhhhhhhhhh...eeee.........hhhhhh....eeeee.............eeee.....hhhhhhhh..eeee........hhhhhhhhhh..eeee..... .......eeee..hhhhhhhh....eee......eeeee.hhhhhhhhhhhhhh..eeee..eeeee..hhhhhhhhhhh.......eeeee.hhh......eeee...hhhhhhhhhhhhhhhhhhhh..eeeeeee.hhhhhhhhhhhhhhh..hhh.eeeee..hhhhhhhhhhhh.eee.......hhhhhhhhhh...ee.....hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.........
sequence :  ..AVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFK... ..IYDNRIVLNGIDLKAFLDSLPDVKIVKM..LNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
seq num:  ..336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       706      ... ..719       729       739     ..762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962       972       982       992       1002      1012      1022   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                            | |                |  |       ^**||||  | |  ||  |  |  |    |   || | |||      ^**     | |              | | || |               | | | ||  ||  | ||   |                 | |           | ||      | |||    |  |  || || |  |       | ||||      |  |    ||| | |          | |    | |  |  |    |  |       | |  |||||| |    || | || ||| ||^**      | |         |  |       ..PS00005..         |  |  || || ||     ..      | ||  |       | |    |  |    |   || |    ||||       ^**  ||||  |    | | |  |          |  ||          || ||      || ||| | ||             || ||             |  ||| |||      | |            | ||  |  |   |    ||| || ||         | | |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                            | |                ^***       ^***|||  | |  ||  |  |  |    |   || | |||              | |              | | ^***               | | | ||  ||  | ||   |                 | |           | ||      | |||    |  |  || || |  |       ^***||      |  |    ||| | |          | |    | |  |  |    |  |       | |  |||||| |    ^*** ^***|| || |       | |         |  |       ..PS00006..         |  |  || ^***|     ..      | |^***       | |    |  |    |   || |    ^***         |  ||||  |    | | |  |          |  ||          || ||      || ||| | ||             || ||             ^***|| |||      | |            | ||  |  |   |    ||| ^***|         | | |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                            | |                             | |||  | |  ||  |  |  |    |   || | |||              | |              | | || |               | | | ||  ||  | ||   |                 | |           | ||      | |||    |  |  || || |  |         ||||      |  |    ||| | |          | |    | |  |  |    |  |       | |  |||||| |     | |  |  || || |       | |         |  |       ..PS00007..         |  |  || ||  |     ..      | |           | |    |  |    |   || |    ||||         |  ||||  |    | | |  |          |  ||          || ||      || ||| | ||             || ||                 || |||      | |            | ||  |  |   |    |*******^         | | |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                            | |                             | |||  ^*****|  |  |  |    |   || | |||              | |              | | || |               | | | ||  ||  | ||   |                 | |           | ||      | ||^*****  |  || || |  |         ||||      |  |    ||| | |          | |    | |  |  |    |  |       | |  ^***** |     | |  |  || || |       | |         |  |       ..PS00008..         |  |  || ||  |     ..      | |           | |    |  |    ^***** |    ||||         |  ||||  |    | | |  |          |  ||          || ||      || |^*****|             || ||                 || |||      | |            | ||  |  |   |    | | ||            | | |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                            | |                             | |||    |   |  |  |  |    |   || | |||              | |              | | || |               | | | |*****  | ||   |                 | |           | ||      | ||        |  || || |  |         ||||      |  |    ||| | |          | |    | |  |  |    |  |       | |   ||||  |     | |  |  || || |       | |         |  |       ..alphabetamotif..         |  |  || ||  |     ..      | |           | |    |  |        |  |    ||||         *****||  |    | | |  |          *****          || ||      || ||| |  |             || ||                 || |||      | |            | ||  |  |   |    | | ||            | | |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                            | |                             | |||    |   |  |  |  |    |   || | |||              | |              | | || |               | | | ||  ||  | ||   |                 | |           | ||      | ||        |  || || |  |         ||||      |  |    ||| | |          | |    | |  |  |    |  |       | |   ||||  |     | |  |  || || |       | |         |  |       ..asxmotif..         |  |  || ||  |     ..      | |           | |    |  |        |  |    ||||         |  | ||  |    | | |  |          |  |           || ||      || ||| |  |             || ||                 || |||      | |            | ||  |  *****    | | ||            | | |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  asxturn ..                            | |                             | |||    |   |  |  |  |    |   || | |||              | |              | ***| |               | | | ||  ||  | ||   |                 | |           | ||      | ||        |  || || |  |         ***|      |  |    *** | |          | |    ***  |  |    |  |       | |   ||||  |     ***  |  || || |       | |         |  |       ..asxturn..         |  |  || ||  |     ..      | |           | |    |  |        |  |    ||||         |  | ||  |    | | |  |          |  |           || ||      || ||| |  |             || ||                 || |||      | |            | ||  |           | | ||            | | |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  betaturn ..                            | |                             ****|    |   |  |  |  |    |   || ****|              | |              | | || |               | | | |****|  | ||   |                 | |           ****      | ||        *******| |  |          | |      |  |     **** |          | |         ****    ****       | |   ||||  |          *******| |       | |         |  |       ..betaturn..         ****  ****|  |     ..      | |           | |    ****        |  |    ||||         **** ||  |    | | |  |          ****           *****      |****| |  |             ****|                 |****|      | |            | ||  |           | | ||            | | |||| |                 |****|       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                            | |                               | |    |   |  |  |  |    |   ||   | |              | |              | | || |               | | | |    |  ***|   |                 | |           | |       | ||            |  | |  |          | |      |  |        | |          | |         |  |               ***   ||||  |              |  | |       | |         |  |       ..gammaturn..                |  |  |     ..      ***           | |                |  |    ||||            | ||  |    | | |  |                                    |  | | |  |              |  |                 |  | |      | |            | ||  |           | | ||            | | |||| |                 |  | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                            ***                               ***    |   |  |  |  |    |   ||   ***              | |              *** |***               *** | |    |  |  |   |                 ***           ***       | ||            |  | |  |          ***      |  |        | |          ***         |  |                     |***  |              |  | |       | |         |  |       ..nest..                |  |  |     ..                    ***                |  |    ****            ***|  |    | | |  |                                    |  *** |  |              |  |                 |  ***      | |            ***|  |           | | ||            | | |||| |                 |  ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                     |   |  *******    |   ||   |                ***                ***                      ***    ****  |   |                                         ****            **** ****                   ****        ***                      ****                     |||****              ******       ***         ****       ..niche..                *******     ..                                       ****                       ****    *** ****                                    |    | ****              ****                 |    |      ***               ****           | ****            | ********                 |    |       
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                     |   |             |   ||   |                                                                         |   |                                         | |                                                                                                       ||||                              | |                    ..schellmannloop..                            ..                                                                                                                      ******                                        ******                                       |   |             |   || |                   ******       
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                     |   |             |   ||   |                                                                         *****                                         | |                                                                                                       ||||                              | |                    ..stmotif..                            ..                                                                                                                                                                                                                 |   |             |   || |                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                     *****             **********                                                                                                                       | |                                                                                                       ||||                              | |                    ..ststaple..                            ..                                                                                                                                                                                                                 *****             *****| |                                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                        ***                                                                                                       ****                              ***                    ..stturn..                            ..                                                                                                                                                                                                                                        ***                                

chain D : CASEIN KINASE II SUBUNIT ALPHA
member of: PANTHER:searchPTHR24054/searchPTHR24054_SF28UniProt:searchP68400
JMol viewer RasMol script viewer  SO4 3D  ..           ** 
JMol viewer RasMol script viewer  UDP 1212C  ..     * **  || 
sec str:  ................
sequence :  ..YPGGSTPVSSANMM
seq num:  ..13        23  
search RasMol script viewer Motif-ligand binding stats  betaturn ..****          

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYLTRANSFERASE 110 KDA SUBUNIT;
member of: GENE3D:searchG3DSA_1.25.40.10PANTHER:searchPTHR23083/searchPTHR23083_SF369PFAM:searchPF00515/searchPF13844PROSITE PROFILES:searchPS50005/searchPS50293, SMART:searchSM00028SUPERFAMILY:searchSSF48452UniProt:searchO15294
JMol viewer RasMol script viewer  SO4 1B  ..                                                                                                                                                                                                                                                                                                                               **                                                                               ..SO4 ..                            ..                                                                                                                                                                                                                                                                           
JMol viewer RasMol script viewer  SO4 5A  ..                                                  ****                                                                                                                                                                                                                                                                         ||                                                                               ..SO4 ..                            ..                                                                                                                                                                                                                                                                           
JMol viewer RasMol script viewer  UDP 1212A  ..                                                  ||||                                                                                                                                                                                              *                                                                          ||                                                                               ..UDP ..                            ..                                                                                *                       * *                          ** *  *  *               ***  *                                                                                                       
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh......hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..................eeeeeee.....hhhhhhhhhhhhhh....eeeeeee......hhhhhhhhhhh.eeee.hhh.hhhhhhhhhhhh...eeee.........hhhhhh....eeee..............eeee.....hhhhhhhh..eeee........hhhhhhhhhh..eeee..... .......eeee..hhhhhhhh....eee......eeeee.hhhhhhhhhhhhhh..eeee..eeeee..hhhhhhhhhhh.......eeeee.hhhh.....eeee...hhhhhhhhhhhhhhhhhhhh..eeeeeee.hhhhhhhhhhhhhhh..hhh.eeeee..hhhhhhhhhhhh.eee.......hhhhhhhhhh...ee.....hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.........
sequence :  ..THADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFK... ..IYDNRIVLNGIDLKAFLDSLPDVKIVKM..LNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
seq num:  ..315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535       545       555       565       575       585       595       605       615       625       635       645       655       665       675       685       695       705       ... ..719       729       739     ..762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962       972       982       992       1002      1012      1022   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|| |         | |||                               | |                |  |       ^**||||  | |  ||  |  |  |    |   || | |||      ^**     | |              | | || |               | | | ||  ||  | ||   |                 | |           | |       | |||    |     || || |  |       | ||||      |  |    ||| | |          | |    | |  |  |    |  |       | |  |||||| |    || | || ||| ||^**      | |         |  |       ..PS00005..         |  |  || || ||     ..      | ||  |       | |    |  |    |   || |    ||||       ^**  ||||  |    | | |  |          |  ||          || ||      || ||| | ||             || ||             |  ||| |||      | |      |   | | ||  |  |   |    ||| || ||         ||| |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***         | |||                               | |                ^***       ^***|||  | |  ||  |  |  |    |   || | |||              | |              | | ^***               | | | ||  ||  | ||   |                 | |           | |       | |||    |     || || |  |       ^***||      |  |    ||| | |          | |    | |  |  |    |  |       | |  |||||| |    ^*** ^***|| || |       | |         |  |       ..PS00006..         |  |  || ^***|     ..      | |^***       | |    |  |    |   || |    ^***         |  ||||  |    | | |  |          |  ||          || ||      || ||| | ||             || ||             ^***|| |||      | |      |   | | ||  |  |   |    ||| ^***|         ||| |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |           | |||                               | |                            || |||  | |  ||  |  |  |    |   || | |||              | |              | | || |               | | | ||  ||  | ||   |                 | |           | |       | |||    |     || || |  |         ||||      |  |    ||| | |          | |    | |  |  |    |  |       | |  |||||| |     | |  |  || || |       | |         |  |       ..PS00007..         |  |  || ||  |     ..      | |           | |    |  |    |   || |    ||||         |  ||||  |    | | |  |          |  ||          || ||      || ||| | ||             || ||                 || |||      | |      |   | | ||  |  |   |    |*******^         ||| |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..**           | |||                               | |                            || |||  ^*****|  |  |  |    |   || | |||              | |              | | || |               | | | ||  ||  | ||   |                 | |           | |       | ||^*****     || || |  |         ||||      |  |    ||| | |          | |    | |  |  |    |  |       | |  ^***** |     | |  |  || || |       | |         |  |       ..PS00008..         |  |  || ||  |     ..      | |           | |    |  |    ^***** |    ||||         |  ||||  |    | | |  |          |  ||          || ||      || |^*****|             || ||                 || |||      | |      |   | | ||  |  |   |    | | ||            ||| |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..             | |||                               | |                            || |||    |   |  |  |  |    |   || | |||              | |              | | || |               | | | |*****  | ||   |                 | |           | |       | ||           || || |  |         ||||      |  |    ||| | |          | |    | |  |  |    |  |       | |   ||||  |     | |  |  || || |       | |         |  |       ..alphabetamotif..         |  |  || ||  |     ..      | |           | |    |  |        |  |    ||||         *****||  |    | | |  |          *****          || ||      || ||| |  |             || ||                 || |||      | |      |   | | ||  |  |   |    | | ||            ||| |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..             | |||                               | |                            || |||    |   |  |  |  |    |   || | |||              | |              | | || |               | | | ||  ||  | ||   |                 | |           | |       | ||           || || |  |         ||||      |  |    ||| | |          | |    | |  |  |    |  |       | |   ||||  |     | |  |  || || |       | |         |  |       ..asxmotif..         |  |  || ||  |     ..      | |           | |    |  |        |  |    ||||         |  | ||  |    | | |  |          |  |           || ||      || ||| |  |             || ||                 || |||      | |      |   | | ||  |  *****    | | ||            ||| |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  asxturn ..             | |||                               | |                            || |||    |   |  |  |  |    |   || | |||              | |              | ***| |               | | | ||  ||  | ||   |                 | |           | |       | ||           || || |  |         ***|      |  |    *** | |          | |    ***  |  |    |  |       | |   ||||  |     ***  |  || || |       | |         |  |       ..asxturn..         |  |  || ||  |     ..      | |           | |    |  |        |  |    ||||         |  | ||  |    | | |  |          |  |           || ||      || ||| |  |             || ||                 || |||      | |      |   | | ||  |           | | ||            ||| |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  betaturn ..             ****|                               | |                            |****|    |   |  |  |  |    |   || ****|              | |              | | || |               | | | |****|  | ||   |                 | |           | |       | ||           ****| |  |          | |      |  |     **** |          | |         ****    ****       | |   ||||  |          *******| |       | |         |  |       ..betaturn..         ****  *****  |     ..      | |           | |    ****        |  |    ||||         **** ||  |    | | |  |          ****           *****      |****| |  |             ****|                 |****|      | |      |   | | ||  |           | | ||            ||| |||| |                 |****|       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..               | |                               | |                            |  | |    |   |  |  |  |    |   ||   | |              | |              | | || |               | | | |    |  ***|   |                 | |           | |       | ||            |  | |  |          | |      |  |        | |          | |         |  |               ***   ||||  |              |  | |       | |         |  |       ..gammaturn..                |  |  |     ..      ***           | |                |  |    ||||            | ||  |    | | |  |                                    |  | | |  |              |  |                 |  | |      | |      |   | | ||  |           | | ||            ||| |||| |                 |  | |       
search RasMol script viewer Motif-ligand binding stats  nest ..               ***                               ***                            |  ***    |   |  |  |  |    |   ||   ***              | |              *** |***               *** | |    |  |  |   |                 ***           ***       | ||            |  | |  |          ***      |  |        | |          ***         |  |                     |***  |              |  | |       | |         |  |       ..nest..                |  |  |     ..                    ***                |  |    ****            ***|  |    | | |  |                                    |  *** |  |              |  |                 |  ***      | |      |   | ***|  |           | | ||            ||| |||| |                 |  ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                                |    |    |   |  *******    |   ||   |                ***                ***                      ***    ****  |   |                                         ****            **** ****                   ****        ***                      ****                     |||****              ******       ***         ****       ..niche..                *******     ..                                       ****                       ****    *** ****                                    |    | ****              ****                 |    |      ***      |   |    ****           | ****            ||********                 |    |       
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                ******    |   |             |   ||   |                                                                         |   |                                         | |                                                                                                       ||||                              | |                    ..schellmannloop..                            ..                                                                                                                      ******                                        ******               |   |                   |   |             ||  || |                   ******       
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                          |   |             |   ||   |                                                                         *****                                         | |                                                                                                       ||||                              | |                    ..stmotif..                            ..                                                                                                                                                                                         |   |                   |   |             ||  || |                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                          *****             **********                                                                                                                       | |                                                                                                       ||||                              | |                    ..ststaple..                            ..                                                                                                                                                                                         *****                   *****             ****** |                                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                                             ***                                                                                                       ****                              ***                    ..stturn..                            ..                                                                                                                                                                                                                                        ***                                

chain B : CASEIN KINASE II SUBUNIT ALPHA
member of: PANTHER:searchPTHR24054/searchPTHR24054_SF28UniProt:searchP68400
JMol viewer RasMol script viewer  SO4 1B  ..           ** 
JMol viewer RasMol script viewer  UDP 1212A  ..     * **  || 
sec str:  ................
sequence :  ..YPGGSTPVSSANMM
seq num:  ..13        23  
search RasMol script viewer Motif-ligand binding stats  betaturn ..****          

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYLTRANSFERASE 110 KDA SUBUNIT;
member of: GENE3D:searchG3DSA_1.25.40.10PANTHER:searchPTHR23083/searchPTHR23083_SF369PFAM:searchPF00515/searchPF13844PROSITE PROFILES:searchPS50005/searchPS50293, SMART:searchSM00028SUPERFAMILY:searchSSF48452UniProt:searchO15294
JMol viewer RasMol script viewer  SO4 3D  ..                                                                                                                                                                                                                                                                                                           *                                                                               ..SO4 ..                            ..                                                                                                                                                                                                                                                                           
JMol viewer RasMol script viewer  UDP 1212C  ..                                                                                                                                                                                                                               *                                                                           |                                                                               ..UDP ..                            ..                                                                                *                       * *                          ** *  *  *               ***  *                                                                                                       
sec str:  ..hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh......hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..................eeeeeee.....hhhhhhhhhhhhhh....eeeeeee......hhhhhhhhhhh.eeee.hhh.hhhhhhhhhhhh...eeee.........hhhhhh....eeeee.............eeee.....hhhhhhhh..eeee........hhhhhhhhhh..eeee..... .......eeee..hhhhhhhh....eee......eeeee.hhhhhhhhhhhhhh..eeee..eeeee..hhhhhhhhhhh.......eeeee.hhh......eeee...hhhhhhhhhhhhhhhhhhhh..eeeeeee.hhhhhhhhhhhhhhh..hhh.eeeee..hhhhhhhhhhhh.eee.......hhhhhhhhhh...ee.....hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.........
sequence :  ..AVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFK... ..IYDNRIVLNGIDLKAFLDSLPDVKIVKM..LNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
seq num:  ..336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       706      ... ..719       729       739     ..762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962       972       982       992       1002      1012      1022   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                            | |                |  |       ^**||||  | |  ||  |  |  |    |   || | |||      ^**     | |              | | || |               | | | ||  ||  | ||   |                 | |           | ||      | |||    |  |  || || |  |       | ||||      |  |    ||| | |          | |    | |  |  |    |  |       | |  |||||| |    || | || ||| ||^**      | |         |  |       ..PS00005..         |  |  || || ||     ..      | ||  |       | |    |  |    |   || |    ||||       ^**  ||||  |    | | |  |          |  ||          || ||      || ||| | ||             || ||             |  ||| |||      | |            | ||  |  |   |    ||| || ||         | | |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                            | |                ^***       ^***|||  | |  ||  |  |  |    |   || | |||              | |              | | ^***               | | | ||  ||  | ||   |                 | |           | ||      | |||    |  |  || || |  |       ^***||      |  |    ||| | |          | |    | |  |  |    |  |       | |  |||||| |    ^*** ^***|| || |       | |         |  |       ..PS00006..         |  |  || ^***|     ..      | |^***       | |    |  |    |   || |    ^***         |  ||||  |    | | |  |          |  ||          || ||      || ||| | ||             || ||             ^***|| |||      | |            | ||  |  |   |    ||| ^***|         | | |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                            | |                             | |||  | |  ||  |  |  |    |   || | |||              | |              | | || |               | | | ||  ||  | ||   |                 | |           | ||      | |||    |  |  || || |  |         ||||      |  |    ||| | |          | |    | |  |  |    |  |       | |  |||||| |     | |  |  || || |       | |         |  |       ..PS00007..         |  |  || ||  |     ..      | |           | |    |  |    |   || |    ||||         |  ||||  |    | | |  |          |  ||          || ||      || ||| | ||             || ||                 || |||      | |            | ||  |  |   |    |*******^         | | |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                            | |                             | |||  ^*****|  |  |  |    |   || | |||              | |              | | || |               | | | ||  ||  | ||   |                 | |           | ||      | ||^*****  |  || || |  |         ||||      |  |    ||| | |          | |    | |  |  |    |  |       | |  ^***** |     | |  |  || || |       | |         |  |       ..PS00008..         |  |  || ||  |     ..      | |           | |    |  |    ^***** |    ||||         |  ||||  |    | | |  |          |  ||          || ||      || |^*****|             || ||                 || |||      | |            | ||  |  |   |    | | ||            | | |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                            | |                             | |||    |   |  |  |  |    |   || | |||              | |              | | || |               | | | |*****  | ||   |                 | |           | ||      | ||        |  || || |  |         ||||      |  |    ||| | |          | |    | |  |  |    |  |       | |   ||||  |     | |  |  || || |       | |         |  |       ..alphabetamotif..         |  |  || ||  |     ..      | |           | |    |  |        |  |    ||||         *****||  |    | | |  |          *****          || ||      || ||| |  |             || ||                 || |||      | |            | ||  |  |   |    | | ||            | | |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                            | |                             | |||    |   |  |  |  |    |   || | |||              | |              | | || |               | | | ||  ||  | ||   |                 | |           | ||      | ||        |  || || |  |         ||||      |  |    ||| | |          | |    | |  |  |    |  |       | |   ||||  |     | |  |  || || |       | |         |  |       ..asxmotif..         |  |  || ||  |     ..      | |           | |    |  |        |  |    ||||         |  | ||  |    | | |  |          |  |           || ||      || ||| |  |             || ||                 || |||      | |            | ||  |  *****    | | ||            | | |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  asxturn ..                            | |                             | |||    |   |  |  |  |    |   || | |||              | |              | ***| |               | | | ||  ||  | ||   |                 | |           | ||      | ||        |  || || |  |         ***|      |  |    *** | |          | |    ***  |  |    |  |       | |   ||||  |     ***  |  || || |       | |         |  |       ..asxturn..         |  |  || ||  |     ..      | |           | |    |  |        |  |    ||||         |  | ||  |    | | |  |          |  |           || ||      || ||| |  |             || ||                 || |||      | |            | ||  |           | | ||            | | |||| |                 || |||       
search RasMol script viewer Motif-ligand binding stats  betaturn ..                            | |                             ****|    |   |  |  |  |    |   || ****|              | |              | | || |               | | | |****|  | ||   |                 | |           ****      | ||        *******| |  |          | |      |  |     **** |          | |         ****    ****       | |   ||||  |          *******| |       | |         |  |       ..betaturn..         ****  ****|  |     ..      | |           | |    ****        |  |    ||||         **** ||  |    | | |  |          ****           *****      |****| |  |             ****|                 |****|      | |            | ||  |           | | ||            | | |||| |                 |****|       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                            | |                               | |    |   |  |  |  |    |   ||   | |              | |              | | || |               | | | |    |  ***|   |                 | |           | |       | ||            |  | |  |          | |      |  |        | |          | |         |  |               ***   ||||  |              |  | |       | |         |  |       ..gammaturn..                |  |  |     ..      ***           | |                |  |    ||||            | ||  |    | | |  |                                    |  | | |  |              |  |                 |  | |      | |            | ||  |           | | ||            | | |||| |                 |  | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                            ***                               ***    |   |  |  |  |    |   ||   ***              | |              *** |***               *** | |    |  |  |   |                 ***           ***       | ||            |  | |  |          ***      |  |        | |          ***         |  |                     |***  |              |  | |       | |         |  |       ..nest..                |  |  |     ..                    ***                |  |    ****            ***|  |    | | |  |                                    |  *** |  |              |  |                 |  ***      | |            ***|  |           | | ||            | | |||| |                 |  ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                     |   |  *******    |   ||   |                ***                ***                      ***    ****  |   |                                         ****            **** ****                   ****        ***                      ****                     |||****              ******       ***         ****       ..niche..                *******     ..                                       ****                       ****    *** ****                                    |    | ****              ****                 |    |      ***               ****           | ****            | ********                 |    |       
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                     |   |             |   ||   |                                                                         |   |                                         | |                                                                                                       ||||                              | |                    ..schellmannloop..                            ..                                                                                                                      ******                                        ******                                       |   |             |   || |                   ******       
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                     |   |             |   ||   |                                                                         *****                                         | |                                                                                                       ||||                              | |                    ..stmotif..                            ..                                                                                                                                                                                                                 |   |             |   || |                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                     *****             **********                                                                                                                       | |                                                                                                       ||||                              | |                    ..ststaple..                            ..                                                                                                                                                                                                                 *****             *****| |                                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                        ***                                                                                                       ****                              ***                    ..stturn..                            ..                                                                                                                                                                                                                                        ***                                

chain D : CASEIN KINASE II SUBUNIT ALPHA
member of: PANTHER:searchPTHR24054/searchPTHR24054_SF28UniProt:searchP68400
JMol viewer RasMol script viewer  SO4 3D  ..           ** 
JMol viewer RasMol script viewer  UDP 1212C  ..     * **  || 
sec str:  ................
sequence :  ..YPGGSTPVSSANMM
seq num:  ..13        23  
search RasMol script viewer Motif-ligand binding stats  betaturn ..****          

   New search    3pe4:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors