| Search | | | PDB header search | | | Upload PDB file | | | Molecule binding | | | Pair bonds | | | Motif binding | | | 3D environment | | | Motif inclusion |
|
|
|
|||||||||||||||||||||||
|
|
PDBe Citation |
|
Chain A sequence:PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT |
|
| 1 | View the assembly/model: (
    ) |
| 2 | View the assembly/model: (
) |
| 3 | View the assembly/model: (
) |
| 4 | View the assembly/model: (
) |
| 5 | View the assembly/model: (
) |
| 6 | View the assembly/model: (
) |
| 7 | View the assembly/model: (
) |
| 8 | View the assembly/model: (
) |
| 9 | View the assembly/model: (
) |
| 10 | View the assembly/model: (
) |
| 11 | View the assembly/model: (
) |
| 12 | View the assembly/model: (
) |
| 13 | View the assembly/model: (
) |
| 14 | View the assembly/model: (
) |
| 15 | View the assembly/model: (
) |
| 16 | View the assembly/model: (
) |
| 17 | View the assembly/model: (
) |
| 18 | View the assembly/model: (
) |
| 19 | View the assembly/model: (
) |
| 20 | View the assembly/model: (
) |
| 21 | View the assembly/model: (
) |
| 22 | View the assembly/model: (
) |
| 23 | View the assembly/model: (
) |
| 24 | View the assembly/model: (
) |
| 25 | View the assembly/model: (
) |
| 26 | View the assembly/model: (
) |
| 27 | View the assembly/model: (
) |
| 28 | View the assembly/model: (
) |
| 29 | View the assembly/model: (
) |
| 30 | View the assembly/model: (
) |
