triangle PDBeMotif: 3pdz  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.1.3.48
Classification hydrolase    | release date: Mon, May 10, 1999
Title solution structure of the pdz2 domain from human phosphatase hptp1e
Authors G.KOZLOV, I.EKIEL, K.GEHRING
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRN
TGQVVHLLLEKGQSPT
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           | |    |    |||^***|         | ||    |||||  |    |  || |  | | |  | | |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           | |    |    |||  ^**         | ||    |||||  |    |  || |  ^** |  ^** |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | |    ^*****^*****          | |^*****||||  |    |  || |      |  | | |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |         | |              | |     ||||****    ****| |      **** | |               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           | |         ***              ***     ||||            | |           ***               
search RasMol script viewer Motif-ligand binding stats  nest ..           | |                                  ****            | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..           ***                                                  ***                             

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                  |    |||^***|         | ||    |||||  |    |  || |  | | |  | |||         | |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                  |    |||  ^**         | ||    |||||  |    |  || |  ^** |  ^**||         | |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                  ^*****^*****          | |^*****||||  |    |  || |      |  | |||         | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       | |              | |     ||||****    ****| |      *******|         | |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       ***              ***     |||||  |        | |           ***         ***   
search RasMol script viewer Motif-ligand binding stats  nest ..                                                ****|  |        | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 *******        ***                             

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           | |    |    || ^***| |       | ||    |||||  |    |  ||||| | ||| |||| |          | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           | |    |    ||   ^** |       | ||    |||||  |    |  ||||| ^**|| |^** |          | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | |    ^*****^*****| |       | |^*****||||  |    |  |||||    || |||| |          | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |                | |       | |     |||||  |    |  |||||    ******| |          | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |                | |       | |     ||||****    ****||||    ***** | |          | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           | |                ***       ***     |||||  |        |***          ***          ***  
search RasMol script viewer Motif-ligand binding stats  nest ..           | |                                  ****|  |        | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..           ***                                   *******        ***                             

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                  |    |||^***| |       | ||    |||||  |    |  || |  | | |  | | |         | |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                  |    |||  ^** |       | ||    |||||  |    |  || |  ^** |  ^** |         | |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                  ^*****^*****| |       | |^*****||||  |    |  || |      |  | | |         | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       | |    | |       | |     ||||****    ****| |      **** | |         | |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       ***    ***       ***     ||||            | |           ***         ***   
search RasMol script viewer Motif-ligand binding stats  nest ..                                                ****            | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                ***                             

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  |      | |    |    |||^***|         | ||  | |||||  |    |  ||||| | | |  ||| |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |      | |    |    |||  ^**         | ||  | |||||  |    |  ||||| ^** |  ^** |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |      | |    ^*****^*****          | |^*****||||  |    |  |||||     |  ||| |               
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |  |      | |         | |              | |   | |||||  |    |  |||||     *****| |               
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****      | |         | |              | |   ****||****    ****||||     **** | |               
search RasMol script viewer Motif-ligand binding stats  gammaturn .. |  |      | |         ***              ***     |||||  |        |***          ***               
search RasMol script viewer Motif-ligand binding stats  nest .. |  |      | |                                  ****|  |        | |                             
search RasMol script viewer Motif-ligand binding stats  niche .. ****      ***                                      ****        ***                             

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                  |    |||^***|         | ||    |||||  |    |  || |  | |||  | |||        | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                  |    |||  ^**         | ||    |||||  |    |  || |  ^**||  ^**||        | |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                  ^*****^*****          | |^*****||||  |    |  || |     ||  | |||        | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       | |              | |     ||||****    ****| |     |*******|        | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       ***              ***     ||||            | |     |   | ***        ***    
search RasMol script viewer Motif-ligand binding stats  nest ..                                                ****            | |     |   |                   
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                ***     |   |                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                        *****                   

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | ||      | |    |    |||^***| |       | ||    |||||  |      | |||| | |||||||| |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | ||      | |    |    |||  ^** |       | ||    |||||  |      | |||| ^**||||^** |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | ||      | |    ^*****^*****| |       | |^*****||||  |      | ||||   |||||||| |               
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | ||      | |         | |    | |       | |     |||||  |      | ||||   |******| |               
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****      | |         | |    | |       | |     ||||****      | ||||   ****** | |               
search RasMol script viewer Motif-ligand binding stats  gammaturn .. ***|      ***         ***    ***       ***     ||||          ******          ***               
search RasMol script viewer Motif-ligand binding stats  nest .. |  |                                           ****            | |                             
search RasMol script viewer Motif-ligand binding stats  niche .. ****                                                           ***                             

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           | |    |    |||^***|         | ||    |||||  |        |||| | | |||| |||               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           | |    |    |||  ^**         | ||    |||||  |        |||| ^** |||^**||               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | |    ^*****^*****          | |^*****||||  |        ||||   | |||| |||               
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |         | |              | |     |||||  |        ||||   *****| |||               
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |         | |              | |     ||||****        ||||   *********|               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           | |         ***              ***     ||||            |***          ***               
search RasMol script viewer Motif-ligand binding stats  nest ..           | |                                  ****            | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..           ***                                                  ***                             

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                  |    |||^***|         | ||    |||||  |    |  ||||| | | |  | | |        | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                  |    |||  ^**         | ||    |||||  |    |  ||||| ^** |  ^** |        | |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                  ^*****^*****          | |^*****||||  |    |  |||||     |  | | |        | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       | |              | |     ||||****    ****||||     **** | |        | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       ***              ***     ||||            |***          ***        ***    
search RasMol script viewer Motif-ligand binding stats  nest ..                                                ****            | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                ***                             

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           |  ||  |    || ^***| |       | ||    |||||  |    |  ||||| | | |  ||| |        | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |  ||  |    ||   ^** |       | ||    |||||  |    |  ||||| ^** |  ^** |        | |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |  ||  ^*****^*****| |       | |^*****||||  |    |  |||||     |  ||| |        | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           *****              | |       | |     |||||  |    |  |||||     *****| |        | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ****               | |       | |     ||||****    ****||||     **** | |        | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                              ***       ***     ||||            |***          ***        ***    
search RasMol script viewer Motif-ligand binding stats  nest ..                                                ****            | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ***            ***                             

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  |             |    |||^***|         | ||   ||||||  |    |  || |  | | || ||| |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |             |    ||| |^**         | ||   ||||||  |    |  || |  ^** || ^** |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |             ^*****^*****          | |^*****||||  |    |  || |    | || ||| |               
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |  |                  | | |            | ||   ||||||  |    |  || |    | *****| |               
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****                  | | |            | ||   |||||****    ****| |    ****** | |               
search RasMol script viewer Motif-ligand binding stats  gammaturn .. |  |                  *****            ***|   |||||            | |           ***               
search RasMol script viewer Motif-ligand binding stats  nest .. |  |                                      |   |****            | |                             
search RasMol script viewer Motif-ligand binding stats  niche .. ****                                      |   |                ***                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                           *****                                                

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                  |    |||^***| |       | ||    |||||  |        | |  | | |||| | |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                  |    ||| |^** |       | ||    |||||  |        | |  ^** |||^** |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                  ^*****^*****| |       | |^*****||||  |        | |    | |||| | |               
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                       | | |  | |       | |     |||||  |        | |    *****| | |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       | | |  | |       | |     ||||****        | |    ****** | |               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       *****  ***       ***     ||||            | |           ***               
search RasMol script viewer Motif-ligand binding stats  nest ..                                                ****            | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                ***                             

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           | |    |    |||^***|         | ||  | |||||  |    |  ||||| | | |  | | |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           | |    |    |||  ^**         | ||  | |||||  |    |  ||||| ^** |  ^** |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | |    ^*****^*****          | |^*****||||  |    |  |||||     |  | | |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |         | |              | |   ****||****    ****||||     **** | |               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           ***         ***              ***     ||||            |***          ***               
search RasMol script viewer Motif-ligand binding stats  nest ..                                                ****            | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                ***                             

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                  |    |||^***|         | ||  | |||||  |    |  || |  | | |  | | |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                  |    |||  ^**         | ||  | |||||  |    |  || |  ^** |  ^** |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                  ^*****^*****          | |^*****||||  |    |  || |      |  | | |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       | |              | |   ****||****    ****| |      **** | |               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       ***              ***     |||||  |        | |           ***               
search RasMol script viewer Motif-ligand binding stats  nest ..                                                ****|  |        | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..                                                    ****        ***                             

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                  |    |||^***|         | ||    |||||  |    |  ||||| | ||| |||| |        | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                  |    |||  ^**         | ||    |||||  |    |  ||||| ^**|| |^** |        | |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                  ^*****^*****          | |^*****||||  |    |  |||||    || |||| |        | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                       | |              | |     |||||  |    |  |||||    |*****| |        | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       | |              | |     ||||****    ****||||    ***** | |        | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       ***              ***     |||||  |        |***          ***        ***    
search RasMol script viewer Motif-ligand binding stats  nest ..                                                ****|  |        | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..                                                    ****        ***                             

16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                  |    |||^***|         | ||    |||||  |    |  || |  | | |  ||| |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                  |    |||  ^**         | ||    |||||  |    |  || |  ^** |  ^** |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                  ^*****^*****          | |^*****||||  |    |  || |      |  ||| |               
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                       | |              | |     |||||  |    |  || |      *****| |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       | |              | |     ||||****    ****| |      **** | |               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       ***              ***     |||||  |        | |           ***               
search RasMol script viewer Motif-ligand binding stats  nest ..                                                ****|  |        | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 *******        ***                             

17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           |  |   |    |||^***|         | ||    |||||  |        | |  | ||| || | |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |  |   |    ||| |^**         | ||    |||||  |        | |  ^**|| |^** |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |  |   ^*****^*****          | |^*****||||  |        | |     || || | |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ****        | | |            | |     ||||****        | |     ***** | |               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       *****            ***     |||||  |        | |           ***               
search RasMol script viewer Motif-ligand binding stats  nest ..                                                ****|  |        | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 *******        ***                             

18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                  |    || ^***| |       | ||  | |||||  |    |  ||||| | | |  | | |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                  |    ||   ^** |       | ||  | |||||  |    |  ||||| ^** |  ^** |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                  ^*****^*****| |       | |^*****||||  |    |  |||||     |  | | |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..                              | |       | |   ****||****    ****||||     **** | |               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                              ***       ***     ||||            |***          ***               
search RasMol script viewer Motif-ligand binding stats  nest ..                                                ****            | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                ***                             

19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           | |    |    |||^***|         | ||    |||||  |        |||| | | |||| |||          | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           | |    |    |||  ^**         | ||    |||||  |        |||| ^** |||^**||          | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | |    ^*****^*****          | |^*****||||  |        ||||   | |||| |||          | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |         | |              | |     |||||  |        ||||   *****| |||          | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |         | |              | |     ||||****        ||||   *********|          | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           | |         ***              ***     ||||            |***          ***          ***  
search RasMol script viewer Motif-ligand binding stats  nest ..           | |                                  ****            | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..           ***                                                  ***                             

20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                  |    |||^***|         | ||    |||||  |    |  || |  | | |  | | |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                  |    |||  ^**         | ||    |||||  |    |  || |  ^** |  ^** |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                  ^*****^*****          | |^*****||||  |    |  || |      |  | | |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       | |              | |     ||||****    ****| |      **** | |               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       ***              ***     ||||            | |           ***               
search RasMol script viewer Motif-ligand binding stats  nest ..                                                ****            | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ***            ***                             

21     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          ||||    |    |||^***|         | ||    |||||  |    |  ||||| | | |||| | |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          ||||    |    |||  ^**         | ||    |||||  |    |  ||||| ^** |||^** |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          ||||    ^*****^*****          | |^*****||||  |    |  |||||   | |||| | |               
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          ||||         | |              | |     |||||  |    |  |||||   *****| | |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ||||         | |              | |     ||||****    ****||||   ****** | |               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          ***|         ***              ***     |||||  |        |***          ***               
search RasMol script viewer Motif-ligand binding stats  nest ..           | |                                  ****|  |        | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..           ***                                   *******        ***                             

22     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                  |    |||^***|         | ||    |||||  |    |  ||||| | | |  | | |        | | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                  |    |||  ^**         | ||    |||||  |    |  ||||| ^** |  ^** |        | | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                  ^*****^*****          | |^*****||||  |    |  |||||     |  | | |        | | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       | |              | |     ||||****    ****||||     **** | |        | | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       ***              ***     ||||            |***          ***        *****  
search RasMol script viewer Motif-ligand binding stats  nest ..                                                ****            | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ***            ***                             

23     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |              |    |||^***|         | ||    |||||  |        |||| | ||| ||||||        |||||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |              |    |||  ^**         | ||    |||||  |        |||| ^**|| |^**||        |||||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |              ^*****^*****          | |^*****||||  |        ||||    || ||||||        |||||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |                   | |              | |     |||||  |        ||||    ******|||        |||||  
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |                   | |              | |     ||||****        ||||    ********|        |||||  
search RasMol script viewer Motif-ligand binding stats  gammaturn .. ***                   ***              ***     ||||            |***          ***        *****  
search RasMol script viewer Motif-ligand binding stats  nest ..                                                ****            | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                ***                             

24     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                  |    |||^***|         | ||  | |||||  |    |  ||||| | | |  ||| |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                  |    ||| |^**         | ||  | |||||  |    |  ||||| ^** |  ^** |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                  ^*****^*****          | |^*****||||  |    |  |||||     |  ||| |               
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                       | | |            | |   | |||||  |    |  |||||     *****| |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       | | |            | |   ****||****    ****||||     **** | |               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       *****            ***     ||||            |***          ***               
search RasMol script viewer Motif-ligand binding stats  nest ..                                                ****            | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                ***                             

25     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           | |    |    |||^***|         | ||    |||||  |        | |  | | |||| | |         | |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           | |    |    ||| |^**         | ||    |||||  |        | |  ^** |||^** |         | |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | |    ^*****^*****          | |^*****||||  |        | |    | |||| | |         | |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |         | | |            | |     |||||  |        | |    *****| | |         | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |         | | |            | |     ||||****        | |    ****** | |         | |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           | |         *****            ***     ||||            | |           ***         ***   
search RasMol script viewer Motif-ligand binding stats  nest ..           | |                                  ****            | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..           ***                                                  ***                             

26     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           | |    |    |||^***|         | ||    |||||  |    |  || |  | | |  | | |        | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           | |    |    |||  ^**         | ||    |||||  |    |  || |  ^** |  ^** |        | |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | |    ^*****^*****          | |^*****||||  |    |  || |      |  | | |        | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |         | |              | |     ||||****    ****| |      **** | |        | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           | |         ***              ***     ||||            | |           ***        ***    
search RasMol script viewer Motif-ligand binding stats  nest ..           | |                                  ****            | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..           ***                                                  ***                             

27     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                  |    |||^***|         | ||  | |||||  |    |  ||||| | ||| |||| |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                  |    |||  ^**         | ||  | |||||  |    |  ||||| ^**|| |^** |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                  ^*****^*****          | |^*****||||  |    |  |||||    || |||| |               
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                       | |              | |   | |||||  |    |  |||||    ******| |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       | |              | |   ****||****    ****||||    ***** | |               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       ***              ***     ||||            |***          ***               
search RasMol script viewer Motif-ligand binding stats  nest ..                                                ****            | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                ***                             

28     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                  |    |||^***|         | ||  | |||||  |    |  ||||| | | |  | | |         | |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                  |    |||  ^**         | ||  | |||||  |    |  ||||| ^** |  ^** |         | |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                  ^*****^*****          | |^*****||||  |    |  |||||     |  | | |         | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       | |              | |   ****||****    ****||||     **** | |         | |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       ***              ***     ||||            |***          ***         ***   
search RasMol script viewer Motif-ligand binding stats  nest ..                                                ****            | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                ***                             

29     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           | |    |    |||^***|         | || |  |||||  |    |  || |  | | |  | |||               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           | |    |    ||| |^**         | || |  |||||  |    |  || |  ^** |  ^**||               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | |    ^*****^*****          | |^*****||||  |    |  || |      |  | |||               
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |         | | |            | |  *****|||  |    |  || |      |  | |||               
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |         | | |            | |  ****|||****    ****| |      *******|               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           ***         *****            ***     ||||            | |           ***               
search RasMol script viewer Motif-ligand binding stats  nest ..                                                ****            | |                             
search RasMol script viewer Motif-ligand binding stats  niche ..                                                 ***            ***                             

30     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
sec str:  .......eeeeee........eeee............eeeee....hhhhh.......eeeee.........hhhhhhhhh.....eeeeee......
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
seq num:  ..1         11        21        31        41        51        61        71        81        91    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  |     |||| |  |    |||^***|         | || || |||||  |    |  || |  | | |||| | |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |     |||| |  |    |||  ^**         | || || |||||  |    |  || |  ^** |||^** |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |     |||| |  ^*****^*****          | |^*****||||  |    |  || |    | |||| | |               
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |  |     |||| |       | |              | |  *****|||  |    |  || |    *****| | |               
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****     |||| |       | |              | |  *****||****    ****| |    ****** | |               
search RasMol script viewer Motif-ligand binding stats  gammaturn .. |  |     ***| |       ***              ***     ||||            | |           ***               
search RasMol script viewer Motif-ligand binding stats  nest .. |  |      ||| |                                ****            | |                             
search RasMol script viewer Motif-ligand binding stats  niche .. ****      *****                                                ***                             

   New search    3pdz:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML