triangle PDBeMotif: 3p1x  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transcription regulator    | release date: Thu, Sep 30, 2010
Title crystal structure of drbm 2 domain of interleukin enhancer-b factor 3 from homo sapiens, northeast structural genomics c target hr4527e
Authors D.WANG, G.T.MONTELIONE, H.JANJUA, H.NEELY, J.F.HUNT, J.LIU, J.SEETHARAMAN, K.CUNNINGHAM, L.OWENS, L.TONG, M.C.BARAN, NO, R, STRUCTURAL GENOMICS CONSORTIUM (NESG), T.B.ACTON
Method X-RAY DIFFRACTION (resolution: 1.90Å)
PDBe Citation   
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
ILTKHGKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERLEUKIN ENHANCER-BINDING FACTOR 3
member of: CATH:search3.30.160.20GENE3D:searchG3DSA_3.30.160.20PANTHER:searchPTHR10910/searchPTHR10910_SF34PFAM:searchPF00035PROSITE PROFILES:searchPS50137, SMART:searchSM00358SUPERFAMILY:searchSSF54768UniProt:searchQ12906
sec str:  ....hhhhhhhhhh....eeeeeee......eeeeeeee..eeeeeee.hhhhhhhhhhhhhhhhhh.....
sequence :  ..GKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPL
seq num:  ..525       535       545       555       565       575       585       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       || ||  |    ||   |  |        |  |   |  ^**               |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       || ||  |    ||   |  |        |  |   ^*****               |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       *****  |    ||   |  |        |  |                        |  |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..       || ||  |    **   |  |        |  |                        |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****|  |         ****        ****                        |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..        *******                                                 ****  

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : INTERLEUKIN ENHANCER-BINDING FACTOR 3
member of: CATH:search3.30.160.20GENE3D:searchG3DSA_3.30.160.20PANTHER:searchPTHR10910/searchPTHR10910_SF34PFAM:searchPF00035PROSITE PROFILES:searchPS50137, SMART:searchSM00358SUPERFAMILY:searchSSF54768UniProt:searchQ12906
sec str:  ....hhhhhhhh......eeeeeee......eeeeeeee..eeeeeee.hhhhhhhhhhhhhhhhhh.
sequence :  ..GKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFP
seq num:  ..525       535       545       555       565       575       585   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       || ||  |    ||               |  |   |  ^**                 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       || ||  |    ||               |  |   ^*****                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       *****  |    ||               |  |                          
search RasMol script viewer Motif-ligand binding stats  betabulge ..       || ||  |    **               |  |                          
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****|  |                     ****                          
search RasMol script viewer Motif-ligand binding stats  niche ..        *******                                                   

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERLEUKIN ENHANCER-BINDING FACTOR 3
member of: CATH:search3.30.160.20GENE3D:searchG3DSA_3.30.160.20PANTHER:searchPTHR10910/searchPTHR10910_SF34PFAM:searchPF00035PROSITE PROFILES:searchPS50137, SMART:searchSM00358SUPERFAMILY:searchSSF54768UniProt:searchQ12906
sec str:  ....hhhhhhhhhh....eeeeeee......eeeeeeee..eeeeeee.hhhhhhhhhhhhhhhhhh.....
sequence :  ..GKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPL
seq num:  ..525       535       545       555       565       575       585       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       || ||  |    ||   |  |        |  |   |  ^**               |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       || ||  |    ||   |  |        |  |   ^*****               |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       *****  |    ||   |  |        |  |                        |  |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..       || ||  |    **   |  |        |  |                        |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****|  |         ****        ****                        |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..        *******                                                 ****  

chain B : INTERLEUKIN ENHANCER-BINDING FACTOR 3
member of: CATH:search3.30.160.20GENE3D:searchG3DSA_3.30.160.20PANTHER:searchPTHR10910/searchPTHR10910_SF34PFAM:searchPF00035PROSITE PROFILES:searchPS50137, SMART:searchSM00358SUPERFAMILY:searchSSF54768UniProt:searchQ12906
sec str:  ....hhhhhhhh......eeeeeee......eeeeeeee..eeeeeee.hhhhhhhhhhhhhhhhhh.
sequence :  ..GKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFP
seq num:  ..525       535       545       555       565       575       585   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       || ||  |    ||               |  |   |  ^**                 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       || ||  |    ||               |  |   ^*****                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       *****  |    ||               |  |                          
search RasMol script viewer Motif-ligand binding stats  betabulge ..       || ||  |    **               |  |                          
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****|  |                     ****                          
search RasMol script viewer Motif-ligand binding stats  niche ..        *******                                                   

   New search    3p1x:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors