triangle PDBeMotif: 3p1s  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification peptide binding protein    | release date: Thu, Sep 30, 2010
Title crystal structure of human 14-3-3 sigma c38n/n166h in comple task-3 peptide and stabilizer fusicoccin a
Authors B.SCHUMACHER, C.ANDERS, C.OTTMANN, N.KATO, P.THIEL, Y.HIGUCHI
Method X-RAY DIFFRACTION (resolution: 1.65Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search FSC FSC binding statistics FSC   search CL CL binding statistics CL
Modified residues:  search SEP SEP binding statistics SEP
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSVEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSE
EKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAM
DISKKEMPPTHPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT
Chain P sequence:
KRRKSV
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : 14-3-3 PROTEIN SIGMA
member of: CATH:search1.20.190.20GENE3D:searchG3DSA_1.20.190.20PANTHER:searchPTHR18860/searchPTHR18860_SF14PFAM:searchPF00244PIRSF:searchPIRSF000868PRINTS:search1433ZETAPROSITE PATTERNS:searchPS00796/searchPS00797, SMART:searchSM00101SUPERFAMILY:searchSSF48445UniProt:searchP31947
JMol viewer RasMol script viewer  MG 252A  ..      *                                                                                                                                                                                                                                     
JMol viewer RasMol script viewer  MG 251A  ..      |                                                                                                                                                              *                                                                      
JMol viewer RasMol script viewer  CL 250A  ..      |      *                                                                          *  *                                                                         |                                                                      
JMol viewer RasMol script viewer  FSC 249A  ..      |      |                                ** **                                     |  |                               *  **                                     |     **                                                 **            
sec str:  ........hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSVEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTHPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT
seq num:  ..-4        6         16        26        36        46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216       226   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| |  |           || |||             | |  |  ||         | |    | |  || | || || |  |      | |   |   |    | |    | |  | |        |       | |  ||  |      | |         ||||||  |    |   ^***     | |  |  ||  || | |  || || | |||| |        ^*** |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| |  |           || |||             | |  |  ||         | |    | |  || | || || |  |      | |   |   |    | |    | |  | |        |       | |  ||  |      ^**         ^**|||  |    |    |       | |  |  ||  || | |  || || | ^**| |         |   |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| |  |           || |||             | |  ^***|         | |    | |  ^*** |^*** |  |      | |   |   |    | |    | |  | |        |       | |  |^***                  ^***||  |    |    |       | ^***  ||  ^*** |  || ^*** ^*** |         |   |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..| |  |           || |||             | |  |   |         | |    | |   |   |  |  |  *******^ |   |   |    | |    | |  | |        ********^ |  |                       |  ||  |    |    |       | |     ||  ||   |  ||  |    |   |         |   |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****           || |||             | |  |   |         | ^***** |   |   |  |  |           |   |   ^***** ^***** |  | |                  |  |                       |  ||  |    ^*****       | |     ||  ||   |  ||  |    |   |         |   |
search RasMol script viewer Motif-ligand binding stats  1433_1 ..  |  |           || |||             | |  |   ***********        |   |   |  |  |           |   |                 |  | |                  |  |                       |  ||  |                 | |     ||  ||   |  ||  |    |   |         |   |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |           || |||             | |  |   |                  |   |   |  |  |           |   |                 |  | |                  |  |                       |  ||  |                 | |     ||  ||   *****  |    |   |         |   |
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****           |****|             | |  |   |                  |   |   |  |  |           |   |                 |  | |                  |  |                       |  |****                 | |     ||  ||   ****|  |    |   |         |   |
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |           |  ***             ***  |   |                  |   |   |  |  |           |   |                 |  | |                  |  |                       |  ||  |                 ***     ||  ||       |  |    |   |         |   |
search RasMol script viewer Motif-ligand binding stats  niche ..  ****           |    |                  |   |                  |   |   *******           |   |                 ******                  ****                       ********                         ||  ||       ****    |   |         |   |
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                 ******                  |   |                  |   |                     |   |                                                                                                     ||  ||               |   |         |   |
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                         *****                  |   |                     |   |                                                                                                     ||  ||               |   |         |   |
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                *****                     *****                                                                                                     ******               *****         *****

chain P : 6-MER PEPTIDE FROM POTASSIUM CHANNEL SUBFAMILY K
member of: PANTHER:searchPTHR11003/searchPTHR11003_SF75UniProt:searchQ9NPC2
JMol viewer RasMol script viewer  FSC 249A  ..     *
sec str:  ........
sequence :  ..KRRKSV
seq num:  ..369   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. **^* 

   New search    3p1s:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors