triangle PDBeMotif: 3n2z  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.16.2
Classification hydrolase    | release date: Wed, May 19, 2010
Title the structure of human prolylcarboxypeptidase at 2.80 angstr resolution
Authors K.J.LUMB, S.B.PATEL, S.M.SOISSON, S.SHARMA
Method X-RAY DIFFRACTION (resolution: 2.79Å)
PDBe Citation   
Small molecules:    search NAG NAG binding statistics NAG   search SO4 SO4 binding statistics SO4
Modified residues:  search ASN ASN binding statistics ASN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain B sequence:
KNYSVLYFQQKVDHFGFNTVKTFNQRYLVADKYWKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFAEHRYY
GESLPFGDNSFKDSRHLNFLTSEQALADFAELIKHLKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGALAASAP
IWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWISETWVN
LAMVDYPYASNFLQPLPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNISETATSSLGTLGWSYQACT
EVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGKNISSHTNIVFSNGELDPWSGGGVTKDITDTL
VAVTISEGAHHLDLRTKNALDPMSVLLARSLEVRHMKNWIRDFYDS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : LYSOSOMAL PRO-X CARBOXYPEPTIDASE
member of: GENE3D:searchG3DSA_3.40.50.1820PANTHER:searchPTHR11010/searchPTHR11010_SF11PFAM:searchPF05577SUPERFAMILY:searchSSF53474UniProt:searchP42785
JMol viewer RasMol script viewer  SO4 492B  ..          *                                                                                                                                                                                                                                                                                                    ..SO4 ..                                                  ***                                                                                      
JMol viewer RasMol script viewer  NAG 6B  ..          |                                                                                                         *       *                                                                                                                                                                                  ..NAG ..                                                  |||         *                                                                        *   
JMol viewer RasMol script viewer  NAG 5B  ..          |                                                                                                         |       |                                                                                             *                                                                                *   ..NAG ..                                                  |||         |                                                                        |   
JMol viewer RasMol script viewer  NAG 3B  ..          |                                                                                                         |       |                                                                                           * |                                                               *   *   *  * **  |   ..NAG ..                                                  |||         |                                                                        |   
JMol viewer RasMol script viewer  NAG 2B  ..          |                                                                                                         |       |                                                                                           | |                                                  ***          |   |   |  | ||  |   ..NAG ..                                                  |||         |                                                                        |   
JMol viewer RasMol script viewer  NAG 1B  ..          |                                            *                                                            |       |                                                                                           | |                                                  |||          |   |   |  | ||  |   ..NAG ..                                                  |||         |                                                                        |   
sec str:  .....eeeeeeee..........eeeeeeeee.........eeeeee....hhhhhhhhhhhhhhhhhhhheeeeee..........hhhhhhh........hhhhhhhhhhhhhhhhhhhh.hhhhh.eeeeeehhhhhhhhhhhhhh.....eeeee.............hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh.hhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhh.....ee...ee..hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh.............. ..hhhhhhhhhhhhhh...................hhhhhhhhhhhhhh.....hhhhhhhh.........eeeeee..hhhhhhh........eeeeee.....hhhhh......hhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..KNYSVLYFQQKVDHFGFNTVKTFNQRYLVADKYWKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFAEHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELIKHLKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWISETWVNLAMVDYPYASNFLQPLPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNISE... ..SLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGKNISSHTNIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSLEVRHMKNWIRDFYDS
seq num:  ..46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336          ... ..353       363       373       383       393       403       413       423       433       443       453       463       473       483      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. ^***       |  |  | |        ||| |          | |||    | ^***      | |||      |  |  |  |  || ||                            | | |     |    |         || || |    |   | || ||     |   |        | |            |  |   |   || |||    |  |      |   |                              | ||^***  |            ^*** |  |^***..PS00001..        |  ||| |     ||||| |                 | |     |  ||| | ^***|     | || |   |    |  |  |   || ||  ||| |   | |   |  ||      |  ||      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..            |  |  ^**        ||| |          | |||    |   |       | |||      |  |  |  |  |^**|                            | | |     |    |         || || |    |   | || ||     |   |        | |            |  |   |   || |||    |  |      |   |                              | || ||   |               | |  || | ..PS00005..        |  ||| |     ||||| |                 | |     |  ||| |  |  |     | || |   |    |  |  |   || ||  ||| |   | |   |  ||      |  ||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..            |  |  | |        ||| |          ^***|    |   |       | |||      |  |  |  |  |^***                            | | |     |    |         || || |    |   | || ||     |   |        | |            |  |   |   || |||    ^***      |   |                              | || ||   |               | |  || | ..PS00006..        |  ||| |     ||||| |                 | |     |  ||| |  |  |     ^*** |   |    |  |  |   ^***|  ||| |   | |   |  ||      |  ||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            |  |  | |        ||| |            | |    |   |       | |||      |  |  |  |  |  |                             | | |     ^*****         || || ^*****   | || ||     |   |        | |            |  |   |   || |||              |   |                              | || ||   |               ^*****| | ..PS00008..        |  ||| |     ||||| |                 | |     |  ||| |  |  |       |  |   ^*****  |  |    |  |  ||| |   | |   |  ||      |  ||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            |  |  | |        ||| |            | |    |   |       | |||      |  |  |  |  |  |                             | | |                    *****          | || ||     |   |        | |            |  |   |   || |||              |   |                              | || ||   |               | |   | | ..alphabetamotif..        *****| |     ||||| |                 | |     *****| |  |  |       |  |           |  |    |  |  ||| |   | |   *****      *****      
search RasMol script viewer Motif-ligand binding stats  asxturn ..            |  |  | |        ||| |            | |    |   |       | |||      |  |  |  |  |  |                             | | |                    || ||          | || ||     |   |        | |            |  |   |   || |||              |   |                              | || ||   |               | |   | | ..asxturn..        |  | | |     ***|***                 | |     |  | | |  |  |       |  |           |  |    |  |  ||| |   | |   |  |       |  |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |  |  | |        ||| |            | |    |   |       ****|      *******  *******                             | | |                    ****|          | ****|     |   |        | |            |  |   |   |****|              |   |                              | || ||   |               | |   | | ..betaturn..        **** | |     |||||                   | |     **** | |  |  |       |  |           |  |    ****  |****   | |   ****       ****       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            |  |  | |        ||| |            ***    |   |         | |      |  |                                         | | |                     |  |          ***|  |     |   |        | |            |  |   |   |  | |              |   |                              ******|   |               | |   | | ..gammaturn..             ***     |||||                   | |          | |  |  |       |  |           |  |    |  |  ||| |   | |                         
search RasMol script viewer Motif-ligand binding stats  nest ..            |  |  | |        ||| |                   |   |         ***      |  |                                         *** |                     |  |             |  |     |   |        ***            |  |   |   |  ***              |   |                                    |   |               ***   | | ..nest..                     ****|                   ***          ***  |  |       |  |           |  |    |  |  *** |   | |                         
search RasMol script viewer Motif-ligand binding stats  niche ..            *********        *****                   |   |                  ****                                           ***                     ****             ****     |   |                       ****   |   |    |              |   |                                    |   |                     *** ..niche..                      ****                                ***  ****       ****           ****    ****   ****   ***                         
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                     |   |                                                                                                                   |   |                              |   ******              |   |                                    |   |                         ..schellmannloop..                                                                                                                                           
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                     |   |                                                                                                                   |   |                              |   |                   |   |                                    *****                         ..stmotif..                                                                                                                                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                     *****                                                                                                                   *****                              *****                   *****                                                                  ..ststaple..                                                                                                                                           

   New search    3n2z:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors