triangle PDBeMotif: 3mxn  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification replication    | release date: Fri, May 7, 2010
Title crystal structure of the rmi core complex
Authors D.XU, J.L.KECK, K.A.HOADLEY, K.A.SATYSHUR, W.WANG, Y.XUE
Method X-RAY DIFFRACTION (resolution: 1.55Å)
PDBe Citation   
Small molecules:    search BEN BEN binding statistics BEN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSHMSSENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDE
ILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
Chain B sequence:
GSHMAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDP
SGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RECQ-MEDIATED GENOME INSTABILITY PROTEIN 1
member of: PANTHER:searchPTHR14790/searchPTHR14790_SF15UniProt:searchQ9H9A7
JMol viewer RasMol script viewer  BEN 1A  ..                                                                                                                                          **  *        
sec str:  ......hhhhhhhhhh....hhhhhhhh.....eeeeeeeeeeee.....hhhhh...eeeee....eeeeeehhhhhhhhhh.hhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhheeeeeeeee....eeeeeeee..hhhhhhhhhhhh..
sequence :  ..ENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
seq num:  ..475       485       495       505       515       525       535       545       555       565       575       585       595       605       615        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    ^*** ||  |                  | |     ||  |^***|||   || | ||||||             | ||  ||  | ||         |    |  |  |        | || |                  | |||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         ||  |                  ^**     ||  |  |||||   |^** ||||||             | ||  ||  ^**|         |    |  |  |        | || |                  | |||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         ||  |                          ||  |  |||||   |  | ||||||             | |^***|  ^***         |    |  |  |        | || |                  | |||
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         ||  |                          ||  |  |||||   |  *******^             | ||   |  |  |         |    |  |  |        | || |                  | |||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         ||  |                          ||  ^*****^*****    |||||              | ||   |  |  |         ^*****  |  |        | || |                  | |||
search RasMol script viewer Motif-ligand binding stats  asxturn ..         ||  |                          ||     ||| |        |||||              | ||   |  |  |                 |  |        ***| |                  | |||
search RasMol script viewer Motif-ligand binding stats  betabulge ..         ||  |                          **     ||| |        |||||              | ||   |  |  |                 |  |           | |                  | |||
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ||  |                                 |****        |||||              | ||   |  |  |                 |  |           | |                  ****|
search RasMol script viewer Motif-ligand binding stats  nest ..         ||  |                                 | |          |****              ***|   |  |  |                 |  |           ***                    ***
search RasMol script viewer Motif-ligand binding stats  niche ..         |****                                 ***          | |                   |   |  ****                 ****                                     
search RasMol script viewer Motif-ligand binding stats  stmotif ..         |   |                                 | |          | |                   *****                                                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..         *****                                 | |          | |                                                                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                                               ***          ***                                                                                        

chain B : RECQ-MEDIATED GENOME INSTABILITY PROTEIN 2
member of: CATH:search2.40.50.140UniProt:searchQ96E14
sec str:  ........ee.hhhhhhhhee......ee.........ee..eeeeeeeeeeee..eeeeee..eeeeeehhhhh...........eeeeeeeeee.....eeeeeeeee....hhhhhhhhhhhhhhhh...
sequence :  ..LPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
seq num:  ..17        27        37        47        57        67        77        87        97        107       117       127       137        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |          |  | ||  ||      | |              ||         | |   ^**||| |       |  |     |  |||             |  |    |  |     || || 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |          |  | ||  ||      | |              ||         | |      ||| |       |  |     |  |||             |  |    ^***     || || 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |          |  | ^*****      | |              ||         | |      ||| |       |  |     ^*****             |  |             || || 
search RasMol script viewer Motif-ligand binding stats  asxturn .. | |          |  |  |  |       | |              ||         ***      ||| |       |  |        ||              |  |             || || 
search RasMol script viewer Motif-ligand binding stats  betabulge .. | |          |  |  |  |       | |              **                  ||| |       |  |        **              |  |             || || 
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |          |  |  ****       | |                                  ||| |       |  |                        |  |             ****| 
search RasMol script viewer Motif-ligand binding stats  nest .. | |          |  |             ***                                  *** |       |  |                        |  |              |  | 
search RasMol script viewer Motif-ligand binding stats  niche .. ***          ****                                                   ****       ****                        ****              **** 

   New search    3mxn:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors