triangle PDBeMotif: 3ma2  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.24.80
Classification hydrolase/hydrolase inhibitor    | release date: Tue, Mar 23, 2010
Title complex membrane type-1 matrix metalloproteinase (mt1-mmp) w inhibitor of metalloproteinase-1 (timp-1)
Authors D.TWOROWSKI, I.SAGI, M.-H.LEE, M.GROSSMAN, O.DYM, Y.LEVY
Method X-RAY DIFFRACTION (resolution: 2.05Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN   search CA CA binding statistics CA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains D,A sequence:
YAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTP
FDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVL
PDDDRRGIQQLYGGESGFPTK
Chains B,C sequence:
CTCAPVHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRS
EEFLIAGKLQDGLLHITLCSFVAPWNSLSLAQRRGFTKTYTVGCE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : MATRIX METALLOPROTEINASE-14
member of: GENE3D:searchG3DSA_3.40.390.10PANTHER:searchPTHR10201/searchPTHR10201_SF24PFAM:searchPF00413PIRSF:searchPIRSF001191PRINTS:searchMATRIXINSMART:searchSM00235SUPERFAMILY:searchSSF55486UniProt:searchP50281
JMol viewer RasMol script viewer  CA 296D  ..                                                                              ** * *                 *  *                                                                  
JMol viewer RasMol script viewer  ZN 295D  ..                                                                       * *    || | |  *            * |  |                                                                  
JMol viewer RasMol script viewer  ZN 294D  ..                                                                       | |    || | |  |            | |  |                   *   *     *                                    
JMol viewer RasMol script viewer  CA 293D  ..                                                             *         | |    || | |  |      * * * | |  |                   |   |     |                                    
sec str:  ..........eeeeee.......hhhhhhhhhhhhhhhhhhhh..eeee.hhhhhhh.......eeeeee...............eeeee..........eeee....ee........eehhhhhhhhhhhhh..........................hhhhhhhhhhhhh.
sequence :  ..QGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGG
seq num:  ..115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | | |        ^** |   ||          |  | ||     |  ||||||                 |  |  |    |      ||| ||  |  |  ^**| | |  |   |  || || |||  ||| ||||| |    | |                | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | | |        | | |   ||          |  | ||     |  ||||||                 ^***  |    |      ||| |^***  |     | | |  |   |  || || |||  ||| ||||| |    | |                | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    | | |        | *******^          |  | |******^  ||||||                       |    |      ||| |   |  |     | | |  |   |  || || |||  ||| ||||| |    | |                | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | | |        | | |   |           |  | |      |  ||||||                       ^*****      ||| |   |  |     | | |  |   |  || || |^*****| ||||| |    | |                ^*
search RasMol script viewer Motif-ligand binding stats  ZINC_PROTEASE ..    | | |        | | |   |           |  | |      |  ||||||                                   ||| |   |  |     | | |  |   ***^^**^**||  | | ||||| |    | |                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | | |        | | |   |           |  | |      *****||||                                   ||| |   |  |     | | |  |   |   | || |||  | | ||||| |    | |                  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    | | |        | | |   |           |  | |      |  | ||||                                   ||| |   |  |     | | |  *****   | || |||  | *****|| |    | |                  
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | | |        | | |   |           |  | |      |  | ||||                                   ||| |   |  |     | ***          | || |||  | ***| || |    ***                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | | |        | | |   |           |  | |      **** ||||                                   |****   |  |     | |            | |****|  | **** || |                         
search RasMol script viewer Motif-ligand binding stats  nest ..    | | |        | | |   |           |  | |           ****                                   ||| |   |  |     ***            | |  ***  | |  | || |                         
search RasMol script viewer Motif-ligand binding stats  niche ..    *****        | | |   |           ******                                                  *****   ****                    | |    |  ***********                         
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                 | | |   |                                                                                                   | ******  | |    |                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 | | *****                                                                                                   |         | |    |                            
search RasMol script viewer Motif-ligand binding stats  stturn ..                 ***                                                                                                         |         ***    |                            
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                             *                *                            

chain C : METALLOPROTEINASE INHIBITOR 1
member of: CATH:search2.40.50.120GENE3D:searchG3DSA_2.40.50.120/searchG3DSA_3.90.370.10PANTHER:searchPTHR11844/searchPTHR11844_SF20PFAM:searchPF00965PROSITE PATTERNS:searchPS00288, PROSITE PROFILES:searchPS50189, SMART:searchSM00206SUPERFAMILY:searchSSF50242UniProt:searchP01033
JMol viewer RasMol script viewer  ZN 294D  ..*                                                 ..                      ..                                               
sec str:  ...ee...hhhhhhhhh.eeeeeee....eee....eeeeeeeeeeeee..........eeeee.hhhhh............eeeeeeeee..eee.....eeee.hhhhhhhhhhhhhhhhh..
sequence :  ..CTCAPVHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQ..AADIRFVYTPAMESVCGYFHRS..NRSEEFLIAGKLQDGLLHITLCSFVAPWNSLSLAQRRGFTKTYTVGC
seq num:  ..301       311       321       331       341       ..355       365         ..378       388       398       408       418    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| |       ||| |              ^*** |          || | ..           || |||     ..^***               |  |    |  |    |   |       
search RasMol script viewer Motif-ligand binding stats  TIMP ..^*^*********^ |              | || |          || | ..           || |||     ..|  |               |  |    |  |    |   |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..          ||  |              ***| |          || | ..           || |||     ..|  |               |  |    |  |    |   |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..          ||  |              |  | |          ** | ..           || |||     ..|  |               |  |    |  |    |   |       
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..          ||  |              ******          |  | ..           || |||     ..|  |               |  |    |  |    |   |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ||  |                 | |          |  | ..           *****|     ..|  |               |  |    |  |    |   |       
search RasMol script viewer Motif-ligand binding stats  nest ..          ||  |                 ***          |  | ..           |  ***     ..|  |               |  |    |  |    |   |       
search RasMol script viewer Motif-ligand binding stats  niche ..          |****                 | |          **** ..           |    |     ..****               ****    ****    |   |       
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..          |   |                 | |               ..           ******     ..                                   |   |       
search RasMol script viewer Motif-ligand binding stats  ststaple ..          *****                 | |               ..                      ..                                   *****       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                ***               ..                      ..                                               

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MATRIX METALLOPROTEINASE-14
member of: GENE3D:searchG3DSA_3.40.390.10PANTHER:searchPTHR10201/searchPTHR10201_SF24PFAM:searchPF00413PIRSF:searchPIRSF001191PRINTS:searchMATRIXINSMART:searchSM00235SUPERFAMILY:searchSSF55486UniProt:searchP50281
JMol viewer RasMol script viewer  CA 296A  ..                                                                            ** * *                 *  *                                                                 
JMol viewer RasMol script viewer  ZN 295A  ..                                                                     * *    || | |  *            * |  |                                                                 
JMol viewer RasMol script viewer  ZN 294A  ..                                                                     | |    || | |  |            | |  |                   *   *     *                                   
JMol viewer RasMol script viewer  CA 293A  ..                                                           *         | |    || | |  |      * * * | |  |                   |   |     |                                   
sec str:  ........eeeeee.......hhhhhhhhhhhhhhhhhhh...eeee.hhhhhhh.......eeeeee...............eeeee..........eeee....ee........eehhhhhhhhhhhhh..........................hhhhhhhhhhhhh
sequence :  ..LKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYG
seq num:  ..117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | | |        ^** |   ||         |   | ||     | || ||||                 |  |  |    |     |||| ||  | ||  ^**| |        |  || || |||  ||| || || |                       |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | |        | | |   ||         |   | ||     | || ||||                 ^***  |    |     |||| |^*** ||     | |        |  || || |||  ||| || || |                       |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  | | |        | *******^         |   | |******^ || ||||                       |    |     |||| |   | ||     | |        |  || || |||  ||| || || |                       |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | | |        | | |   |          |   | |        || ||||                       ^*****     |||| |   | ||     | |        |  || || |^*****| || || |                       ^
search RasMol script viewer Motif-ligand binding stats  ZINC_PROTEASE ..  | | |        | | |   |          |   | |        || ||||                                  |||| |   | ||     | |        ***^^**^**||  | | || || |                        
search RasMol script viewer Motif-ligand binding stats  asxturn ..  | | |        | | |   |          |   | |        || ||||                                  |||| |   ***|     | |            | || |||  | ***| || |                        
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | | |        | | |   |          |   | |        |****||                                  ||****   |  |     | |            | |****|  | |  | || |                        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  | | |        | | |   |          |   | |        |  ||||                                  ***| |   |  |     | |            | |  | |  | |  | || |                        
search RasMol script viewer Motif-ligand binding stats  nest ..  | | |        | | |   |          |   | |        |  ****                                   ||| |   |  |     ***            | |  ***  | |  | || |                        
search RasMol script viewer Motif-ligand binding stats  niche ..  *****        | | |   |          |   ***        |    |                                    *****   ****                    | |    |  ***********                        
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..               | | |   |          |   |          ******                                                                    | ******         |                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..               | | *****          *****                                                                                    |                |                           
search RasMol script viewer Motif-ligand binding stats  stturn ..               ***                                                                                                         |                |                           
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                           *                *                           

chain B : METALLOPROTEINASE INHIBITOR 1
member of: CATH:search2.40.50.120GENE3D:searchG3DSA_2.40.50.120/searchG3DSA_3.90.370.10PANTHER:searchPTHR11844/searchPTHR11844_SF20PFAM:searchPF00965PROSITE PATTERNS:searchPS00288, PROSITE PROFILES:searchPS50189, SMART:searchSM00206SUPERFAMILY:searchSSF50242UniProt:searchP01033
JMol viewer RasMol script viewer  ZN 294A  ..*                                                ..                                                                    
sec str:  ...ee...hhhhhhhhh.eeeeeeeeeeeeee....eeeeeeeeeeeee.......eeeee.hhhhh...........eeeeeeeee..eee......eee.hhhhhhhhhhhhhhhhhh.
sequence :  ..CTCAPVHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGF..DIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITLCSFVAPWNSLSLAQRRGFTKTYTVGC
seq num:  ..301       311       321       331       341      ..357       367       377       387       397       407       417     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| |       ||| |              ^*** |          ||  ..         || |||  | | ^***        |  |   | |||  || |||   |           
search RasMol script viewer Motif-ligand binding stats  TIMP ..^*^*********^ |              | || |          ||  ..         || |||  | | |  |        |  |   | |||  || |||   |           
search RasMol script viewer Motif-ligand binding stats  asxturn ..          ||  |              ***| |          ||  ..         || |||  | | |  |        |  |   | |||  || |||   |           
search RasMol script viewer Motif-ligand binding stats  betabulge ..          ||  |              |  | |          **  ..         || |||  | | |  |        |  |   | |||  || |||   |           
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..          ||  |              ******              ..         || |||  | | |  |        |  |   | |||  || |||   |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ||  |                 | |              ..         *****|  | | |  |        ****   ****|  *****|   |           
search RasMol script viewer Motif-ligand binding stats  nest ..          ||  |                 ***              ..         |  ***  | | |  |               | |||   |  ||   |           
search RasMol script viewer Motif-ligand binding stats  niche ..          |****                                  ..         |    |  *** ****               ****|   ****|   |           
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..          |   |                                  ..         ******    | |                  | | |       |   |           
search RasMol script viewer Motif-ligand binding stats  stmotif ..          |   |                                  ..                   | |                  *****       *****           
search RasMol script viewer Motif-ligand binding stats  ststaple ..          *****                                  ..                   | |                  | |                         
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                 ..                   ***                  ***                         

   New search    3ma2:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors