triangle PDBeMotif: 3lzn  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transport protein    | release date: Mon, Mar 1, 2010
Title crystal structure analysis of the apo p19 protein from campy jejuni at 1.59 a at ph 9
Authors A.B.RAMIN, A.C.K.CHAN, M.E, M.SCOFIELD, S.A.L.TOM-YEW, T.I.DOUKOV
Method X-RAY DIFFRACTION (resolution: 1.59Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN   search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GGEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAI
KRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : P19 PROTEIN
JMol viewer RasMol script viewer  ZN 200B  ..                                                                                                                                                              
JMol viewer RasMol script viewer  SO4 300A  ..     ** *                                                                                                                                           **        
JMol viewer RasMol script viewer  ZN 200A  ..     || |                               *                                             *      *                                                      ||        
sec str:  ....eeeeeeeee..eeeeeeee....ee......hhhhh.eeeeeeeee.................eeeeeeee.....eeeeeeeeeee..eeeeeeee............eeeeeeeeeehhhhhh.eee.............eeeeeeeee.....
sequence :  ..GEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..          | ||   |           | |  || |||        |  | | ||  | |  |       | || | **^*     |  |   |    |  | |              || | |||  | ||  |                  | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          | ||   |           | |  || |||        |  | | ||  | |  |       | || |          |  |   |    |  | |              || | |||  | ||  |                  ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          | ||   |           | |  |^***|        |  | | ||  | |  |       | || |          |  |   |    |  | |              ^*** |||  | ||  |                  | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | ^*****           ^*****  |||        |  | | ||  | |  |       | || |          |  |   ^*****  | |               | | |||  | ||  |                  | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  |               | |  |  |||        |  *** ||  | |  |       ***| |          |  |        |  ***               *** |||  | ||  |                  | |
search RasMol script viewer Motif-ligand binding stats  betabulge ..          |  |               | |  |  |**        |  | | ||  | |  |          | |          |  |        |  |                   | |||  | ||  |                  | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ****               | |  ****          |  | | |**** |  |          | |          ****        ****                   ****|  | ||  |                  | |
search RasMol script viewer Motif-ligand binding stats  nest ..                             ***  |  |          |  | ***|  | |  |          ***                      |  |                     ***  | ||  |                  | |
search RasMol script viewer Motif-ligand binding stats  niche ..                                  ****          ****    **** ****          | |                      ****                          *******                  | |
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                           ***                                                                             ***

chain B : P19 PROTEIN
JMol viewer RasMol script viewer  SO4 300B  ..                                                **                                                                                                            
JMol viewer RasMol script viewer  ZN 200B  ..                                        *       ||                                    *      *                                                                
JMol viewer RasMol script viewer  ZN 200A  ..                                        |       ||                                    |      |                                    *                           
sec str:  ...eeeeeeeeee..eeeeeeee....ee......hhhhh.eeeeeeeee.................eeeeeeee.....eeeee.eeeee..eeeeeeee............eeeeeeeeeehhhhhh.eee.............eeeeeeeee.....
sequence :  ..GEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..            |    |           | |  || |||        |  | | ||  | |  |       | || | **^*     |  |   |    |  | |              || | |||  | ||  |                  | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..            |    |           | |  || |||        |  | | ||  | |  |       | || |          |  |   |    |  | |              || | |||  | ||  |                  ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..            |    |           | |  |^***|        |  | | ||  | |  |       | || |          |  |   |    |  | |              ^*** |||  | ||  |                     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            ^*****           ^*****  |||        |  | | ||  | |  |       | || |          |  |   ^*****  | |               | | |||  | ||  |                     
search RasMol script viewer Motif-ligand binding stats  asxturn ..                             | |  |  |||        |  *** ||  | |  |       ***| |          |  |        |  ***               *** |||  | ||  |                     
search RasMol script viewer Motif-ligand binding stats  betabulge ..                             | |  |  |**        |  | | ||  | |  |          | |          |  |        |  |                   | |||  | ||  |                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                             | |  |  |          |  | | |**** |  |          | |          ****        ****                   ****|  | ||  |                     
search RasMol script viewer Motif-ligand binding stats  nest ..                             ***  |  |          |  | ***|  | |  |          ***                      |  |                     ***  | ||  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..                                  ****          ****    **** ****          | |                      ****                          *******                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                           ***                                                                                

   New search    3lzn:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors