triangle PDBeMotif: 3lra  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Download structure factors file
Classification membrane protein    | release date: Wed, Feb 10, 2010
Title structural basis for assembling a human tripartite complex d mals3
Authors J.LONG, X.XIE, X.YANG, Y.SHEN
Method X-RAY DIFFRACTION (resolution: 2.95Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
PVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKLEVLFQGPGSDTGLYE
LLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSLVKIHEKLHYYEKQSPVPILHGAAALADDLAEELQNKPLNSEIRELL
KLLSKPNVKALLSVHDTVAQKNYDLEVLFQGPALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAV
REVYEHVYETVDIS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DISKS LARGE HOMOLOG 1, MAGUK P55 SUBFAMILY MEMBERPROTEIN LIN-7 HOMOLOG C;
sec str:  ....hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhh......hhhhhhhhhhhhhh......hhhhhhhhhh..hhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhh...hhhhhhhhhhh.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...
sequence :  ..PVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKLEVLFQGPGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMF..SLHSLVKIHEKLHYYEKQSPVPILHGAAALADDLAEELQNKPLNSEIRELLKLLSKPNVKALLSVHDTVAQKNYDLEVLFQGPALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDIS
seq num:  ..2         12        22        32        42        52        62        72        82        92        102   ..111       121       131       141       151       161       171       181       191       201       211       221       231       241       251  
search RasMol script viewer Motif-ligand binding stats  PS00005 ..      ^**        |  ||  | |   |  |    |  |            | ||  |   | || |  | |||||          |  | | ||        ..      |      ||| ||         |  ||   || ||           |  |       |  |   | | || ||| |                     |   |             |  | |    |      |  |   
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                 |  |^*** |   ^***    |  |            | |^***   | || |  | |||||          |  | ^***        ..      |      ||| ||         |  ||   || ||           |  |       ^***   | | || ||| |                     |   |             |  | |    |      |  |   
search RasMol script viewer Motif-ligand binding stats  PS00007 ..                 |  |   | |           |  |            | |       | || |  | |||||          |  | | |         ..      *******^|| ||         |  ||   || ||           |  |              | | || ||| |                     |   |             |  | |    *******^  |   
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                 |  |   | |           |  |            | |       | || |  ^*****|          |  | | |         ..              || ||         |  ||   || ||           |  |              | | || ||| |                     |   |             |  | |           |  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 |  |   | |           |  |            | |       | || |  | |||||          |  | | |         ..              || ||         *****   || ||           |  |              | | ****** |                     |   |             |  | |           |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 |  |   | |           |  |            | |       **** |  | |||||          |  | | |         ..              *****         ****    ****|           ****              | | ********                     |   |             |  | |           |  |   
search RasMol script viewer Motif-ligand binding stats  nest ..                 |  |   ***           |  |            ***         |  |  *******          |  | | |         ..               |  |                  |  |           |  |              ***                              |   |             |  | |           |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..                 ****                 ****                        ****                   **** | |         ..               ****                  ****           ****                                               |   |             **** |           ****   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                              | |         ..                                                                                                       *****                | |                  
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                              ***         ..                                                                                                                            ***                  

   New search    3lra:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML  |  Structure factors