triangle PDBeMotif: 3lnx  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein    | release date: Wed, Feb 3, 2010
Title second pdz domain from human ptp1e
Authors A.CHANG, A.L.LEE, CENTER FOR, EUKARYOTIC STRUCTURAL GENOMICS (CESG), G.N.PHILLIPS JR., H.KE, J.ZHANG
Method X-RAY DIFFRACTION (resolution: 1.64Å)
PDBe Citation   
Small molecules:    search IOD IOD binding statistics IOD   search SCN SCN binding statistics SCN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D,E,F sequence:
PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRN
TGQVVHLLLEKGQSPT
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE13;
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
JMol viewer RasMol script viewer  SCN 101F  ..                                                                                 **           
JMol viewer RasMol script viewer  IOD 100C  ..                                                                                 ||           
JMol viewer RasMol script viewer  SCN 103B  ..                                                        *         *              ||           
JMol viewer RasMol script viewer  SCN 102B  ..                                                        * *       |              ||           
JMol viewer RasMol script viewer  SCN 101B  ..     *                                                  | |       |              ||           
JMol viewer RasMol script viewer  SCN 103A  ..     |                                                  | |****   |              ||  ***      
JMol viewer RasMol script viewer  IOD 102A  ..*    |                                                  | |||||   |              ||  |||  *   
JMol viewer RasMol script viewer  IOD 101A  ..|    |       *                                 *        | |||||   |              ||  |||  |   
JMol viewer RasMol script viewer  IOD 100A  ..|    |       |                                 |        | |||||   |    *         ||  |||  |   
JMol viewer RasMol script viewer  IOD 99A  ..|    |       |               **                |        | |||||   |    |         ||  |||  |   
JMol viewer RasMol script viewer  IOD 98A  ..|    |       |               ||                |        | |||||   |    |         |** |||  |   
JMol viewer RasMol script viewer  IOD 97A  ..|    |       |  **           ||                |        | |||||   |    |      *  ||| |||  |   
sec str:  .......eeeeeee.......eeeee.....hhhh.eeeeee...hhhhhhh......eeeee..ee....hhhhhhhhhhh...eeeeeee....
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQS
seq num:  ..1         11        21        31        41        51        61        71        81        91  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  |           ||||   || ^***| ||      |  |    |||||  |  |||  |||| || | |  | |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |           ||||   ||  |^** ||      |  |    |||||  |  |||  |||| |^** |  ^**               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |           ||^*****^*****| ||      |  ^*****||||  |  |||  |||| ||   |                    
search RasMol script viewer Motif-ligand binding stats  betabulge .. |  |           ||||    |  | || ||      |  |    |||||  |  **|  |||| ||   |                    
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****           ||||    |  | *****      ****    ||||****    ****|****|   |                    
search RasMol script viewer Motif-ligand binding stats  nest .. |  |           |***    |  | |          |  |    ****|  |        ||| ||   |                    
search RasMol script viewer Motif-ligand binding stats  niche .. ****           | |     ******          ****     *******        *****|   |                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                | |        | |                                  | |  *****                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                ***        ***                                  ***                           

chain B : TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE13;
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
JMol viewer RasMol script viewer  IOD 98F  ..                                                                                              
JMol viewer RasMol script viewer  IOD 99D  ..             *                                 *                                              
JMol viewer RasMol script viewer  SCN 103B  ..             |                                 |        * *                                   
JMol viewer RasMol script viewer  SCN 102B  ..             |                                 |        * *                                   
JMol viewer RasMol script viewer  SCN 101B  ..             |                                 |        | |****                      ***      
JMol viewer RasMol script viewer  IOD 100B  ..*            |                                 |        | |||||                      |||  *   
JMol viewer RasMol script viewer  IOD 99B  ..|            |                                 |        | |||||       **  *          |||  |   
JMol viewer RasMol script viewer  IOD 98B  ..|          * |                                 |        | |||||       ||  |       ** |||  |   
JMol viewer RasMol script viewer  IOD 97B  ..|          | |  **                             |        | |||||       ||  |       || |||  |   
JMol viewer RasMol script viewer  SCN 103A  ..|    *     | |  ||                             |        | |||||       ||  |       || |||  |   
sec str:  .......eeeeeee.......eeeee..........eeeeee...hhhhhhh......eeeee..ee....hhhhhhhhhhh...eeeeeee....
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQS
seq num:  ..1         11        21        31        41        51        61        71        81        91  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  |        |  ||||   || ^***||||      |  |    |||||  |  ||    ||| || |    | |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |        |  ||||   ||  |^**|||      |  |    |||||  |  ||    ||| |^**    ^**               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |        |  ||^*****^***** |||      |  ^*****||||  |  ||    ||| |                         
search RasMol script viewer Motif-ligand binding stats  betabulge .. |  |        |  ||||    |  | | |||      |  |    |||||  |  **    ||| |                         
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****        ****|||    **** ****|      ****    ||||****        |****                         
search RasMol script viewer Motif-ligand binding stats  nest .. |  |           |***    |  | | ***      |  |    ****|  |        ||| |                         
search RasMol script viewer Motif-ligand binding stats  niche .. ****           | |     ******          ****     *******        *****                         
search RasMol script viewer Motif-ligand binding stats  stturn ..                ***        ***                                  ***                           

chain C : TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE13;
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
JMol viewer RasMol script viewer  SCN 104E  ..                                                          *                                   
JMol viewer RasMol script viewer  SCN 102E  ..                                                          |                                   
JMol viewer RasMol script viewer  SCN 101E  ..                                                          |                                   
JMol viewer RasMol script viewer  IOD 101D  ..                                                          |                      **           
JMol viewer RasMol script viewer  SCN 102C  ..                    **                                    |           *          ||           
JMol viewer RasMol script viewer  SCN 101C  ..                    ||                                    |****       |          ||  ***      
JMol viewer RasMol script viewer  IOD 100C  ..*                   ||                                    |||||       |          ||  |||  *   
JMol viewer RasMol script viewer  IOD 99C  ..|                   ||                **                  |||||       |          ||  |||  |   
JMol viewer RasMol script viewer  IOD 98C  ..|                   ||*             **||              *   |||||       |          ||  |||  |   
JMol viewer RasMol script viewer  IOD 97C  ..|                *  |||             ||||              |   |||||       |          ||  |||  |   
JMol viewer RasMol script viewer  IOD 98B  ..|          *     |  |||             ||||              |   |||||       |          |** |||  |   
JMol viewer RasMol script viewer  IOD 102A  ..|          |     |  |||             ||||              |   |||||       |          ||| |||  |   
sec str:  .......eeeeeee.......eeeee..........eeeeee...hhhhhhh......eeeee..ee....hhhhhhhhhhh...eeeeeee....
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQS
seq num:  ..1         11        21        31        41        51        61        71        81        91  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  |        |  ||||   || ^***||||   || |  |    |||||  |  ||    ||| || | |  | |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |        |  ||||   ||  |^**|||   || |  |    |||||  |  ||    ||| |^** |  ^**               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |        |  ||^*****^***** |||   || |  ^*****||||  |  ||    ||| ||   |                    
search RasMol script viewer Motif-ligand binding stats  betabulge .. |  |        |  ||||    |  | | |||   ** |  |    |||||  |  **    ||| ||   |                    
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****        ****|||    |  | ****|      ****    ||||****        |****|   |                    
search RasMol script viewer Motif-ligand binding stats  nest .. |  |           |***    |  | | ***      |  |    ****|  |        ||| ||   |                    
search RasMol script viewer Motif-ligand binding stats  niche .. ****           | |     ******          ****     *******        *****|   |                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                | |        | |                                  | |  *****                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                ***        ***                                  ***                           

chain D : TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE13;
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
JMol viewer RasMol script viewer  SCN 100F  ..                                                                                              
JMol viewer RasMol script viewer  SCN 102D  ..                                                           ****                      ***      
JMol viewer RasMol script viewer  IOD 101D  ..                                               *           ||||                      |||      
JMol viewer RasMol script viewer  IOD 100D  ..*                                              |    *      ||||                      |||  *   
JMol viewer RasMol script viewer  IOD 99D  ..|                                              |    |      ||||                  **  |||  |   
JMol viewer RasMol script viewer  IOD 98D  ..|             *                                |    |      ||||                  ||  |||  |   
JMol viewer RasMol script viewer  IOD 97D  ..|             | **                             |    |      ||||                  ||  |||  |   
JMol viewer RasMol script viewer  IOD 98B  ..|             | ||                             |    |      ||||                  |** |||  |   
sec str:  .......eeeeeee.......eeeee.....hhhh.eeeeee...hhhhhhh......eeeee..ee....hhhhhhhhhhh...eeeeeee....
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQS
seq num:  ..1         11        21        31        41        51        61        71        81        91  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  |        |  ||||   || ^***| ||      |  |    |||||  |        ||| || |    | |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |        |  ||||   ||  |^** ||      |  |    |||||  |        ||| |^**    ^**               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |        |  ||^*****^*****| ||      |  ^*****||||  |        ||| |                         
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****        ****|||    **** *****      ****    ||||****        |****                         
search RasMol script viewer Motif-ligand binding stats  nest .. |  |           |***    |  | |          |  |    ****|  |        ||| |                         
search RasMol script viewer Motif-ligand binding stats  niche .. ****           | |     ******          ****        ****        *****                         
search RasMol script viewer Motif-ligand binding stats  stturn ..                ***                                             ***                           

chain E : TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE13;
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
JMol viewer RasMol script viewer  SCN 104E  ..                                                        *        **                           
JMol viewer RasMol script viewer  SCN 103E  ..             *                                 *        |        ||                           
JMol viewer RasMol script viewer  SCN 102E  ..             |                                 |        |  ****  ||                  ***      
JMol viewer RasMol script viewer  SCN 101E  ..             |                                 |        * *||||  ||                  |||      
JMol viewer RasMol script viewer  IOD 100E  ..*            |                                 |    *   | |||||  ||                  |||  *   
JMol viewer RasMol script viewer  IOD 99E  ..|            |        **                       |    |   | |||||  ||                  |||  |   
JMol viewer RasMol script viewer  IOD 98E  ..|            |  **    ||                       |    |   | |||||  ||                  |||  |   
JMol viewer RasMol script viewer  IOD 97E  ..|            |  ||    ||     **                |    |   | |||||  ||                  |||  |   
JMol viewer RasMol script viewer  IOD 100D  ..|            |  ||    ||     ||                |    |   | |||||  ||                  |||  |   
JMol viewer RasMol script viewer  SCN 101C  ..|            |  ||    ||     ||                |    |   | |||||  ||                  |||  |   
JMol viewer RasMol script viewer  IOD 101A  ..|            |  ||    ||     ||                |    |   | |||||  ||              *   |||  |   
JMol viewer RasMol script viewer  IOD 98A  ..|          * |  ||    ||     ||                |    |   | |||||  ||              |*  |||  |   
sec str:  .......eeeeeee.......eeeee.....hhhh.eeeeee...hhhhhhh......eeeee..ee....hhhhhhhhhhh...eeeeeee....
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQS
seq num:  ..1         11        21        31        41        51        61        71        81        91  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  |           ||||   || ^***| ||      |  |    |||||  |        ||| || | |  | |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |           ||||   ||  |^** ||      |  |    |||||  |        ||| |^** |  ^**               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |           ||^*****^*****| ||      |  ^*****||||  |        ||| ||   |                    
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****           ||||    **** *****      ****    ||||****        |****|   |                    
search RasMol script viewer Motif-ligand binding stats  nest .. |  |           |***       | |          |  |    ****|  |        ||| ||   |                    
search RasMol script viewer Motif-ligand binding stats  niche .. ****           | |        ***          ****     *******        *****|   |                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                | |        | |                                  | |  *****                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                ***        ***                                  ***                           

chain F : TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE13;
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR19134/searchPTHR19134_SF197PFAM:searchPF00595PIRSF:searchPIRSF000933PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ12923
JMol viewer RasMol script viewer  SCN 101F  ..             *                                 *                                              
JMol viewer RasMol script viewer  SCN 100F  ..             |                                 |           ****                      ***      
JMol viewer RasMol script viewer  SCN 99F  ..             |                                 |           ||||       **             |||      
JMol viewer RasMol script viewer  IOD 98F  ..*            |                                 |    *      ||||       ||             |||  *   
JMol viewer RasMol script viewer  IOD 97F  ..|            |  **                             |    |      ||||       ||     *       |||  |   
JMol viewer RasMol script viewer  SCN 103E  ..|            |  ||                             |    |      ||||       ||     |   **  |||  |   
JMol viewer RasMol script viewer  SCN 102D  ..|            |  ||                             |    |      ||||       ||     |   ||  |||  |   
JMol viewer RasMol script viewer  IOD 100B  ..|            |  ||                             |    |      ||||       ||     |   ||  |||  |   
JMol viewer RasMol script viewer  IOD 98A  ..|          * |  ||                             |    |      ||||       ||     |   |** |||  |   
sec str:  .......eeeeeee.......eeeee.....hhhh.eeeeee...hhhhhhh......eeeee..ee....hhhhhhhhhhh...eeeeeee....
sequence :  ..PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQS
seq num:  ..1         11        21        31        41        51        61        71        81        91  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  |           ||||   || ^***|         |  |    |||||  |        ||| || | |  | |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |           ||||   ||  |^**         |  |    |||||  |        ||| |^** |  ^**               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |           ||^*****^*****          |  ^*****||||  |        ||| ||   |                    
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****           ||||    |  |            ****    ||||****        |****|   |                    
search RasMol script viewer Motif-ligand binding stats  nest .. |  |           |***    |  |            |  |    ****|  |        ||| ||   |                    
search RasMol script viewer Motif-ligand binding stats  niche .. ****           | |     ****            ****        ****        *****|   |                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                | |                                             | |  *****                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                ***                                             ***                           

   New search    3lnx:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors