triangle PDBeMotif: 3l73  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.10.2.2
Classification oxidoreductase    | release date: Sun, Dec 27, 2009
Title cytochrome bc1 complex from chicken with triazolone inhibito
Authors E.A.BERRY, L.HUANG
Method X-RAY DIFFRACTION (resolution: 3.04Å)
PDBe Citation   
Small molecules:    search UQ UQ binding statistics UQ   search BOG BOG binding statistics BOG   search HEM HEM binding statistics HEM   search CDL CDL binding statistics CDL   search PEE PEE binding statistics PEE   search HEC HEC binding statistics HEC   search GOL GOL binding statistics GOL   search JZZ JZZ binding statistics JZZ   search FES FES binding statistics FES
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,N sequence:
AATYAQTLQNIPETNVTTLDNGLRVASEESSQPTCTVGVWIGAGSRYENEKNNGAGYFVEHLAFKGTKKRPCAAFEKEVE
SMGAHFNGYTSREQTAFYIKALSKDMPKVVELLADVVQNCALEESQIEKERGVILQELKEMDNDMTNVTFDYLHATAFQG
TALARTVEGTTENIKHLTRADLASYIDTHFKAPRMVLAAAGGISHKELVDAARQHFSGVSFTYKEDAVPILPRCRFTGSE
IRARDDALPVAHVALAVEGPGWADPDNVVLHVANAIIGRYDRTFGGGKHLSSRLAALAVEHKLCHSFQTFNTSYSDTGLF
GFHFVADPLSIDDMMFCAQGEWMRLCTSTTESEVKRAKNHLRSAMVAQLDGTTPVCETIGSHLLNYGRRISLEEWDSRIS
AVDARMVRDVCSKYIYDKCPALAAVGPIEQLLDYNRIRSGMYWIRF
Chains B,O sequence:
SLKVAPKVAVSAAAERVKLCPGAEDLEITKLPNGLIIASLENFSPASRIGVFIKAGSRYETTANLGTAHLLRLASPLTTK
GASSFRITRGIEAVGGSLSVYSTREKMTYCVECLRDHVDTVMEYLLNVTTAPEFRPWEVTDLQPQLKVDKAVAFQSPQVG
VLENLHAAAYKTALANPLYCPDYRIGKITSEQLHHFVQNNFTSARMALVGIGVKHSDLKQVAEQFLNIRSGAGTSSAKAT
YWGGEIREQNGHSLVHAAVVTEGAAVGSAEANAFSVLQHVLGAGPLIKRGSSVTSKLYQGVAKATTQPFDASAFNVNYSD
SGLFGFYTISQAAHAGEVIRAAMNQLKAAAQGGVTEEDVTKAKNQLKATYLMSVETAQGLLNEIGSEALLSGTHTAPSVV
AQKIDSVTSADVVNAAKKFVSGKKSMAASGDLGSTPFLDEL
Chains C,P sequence:
MAPNIRKSHPLLKMINNSLIDLPAPSNISAWWNFGSLLAVCLMTQILTGLLLAMHYTADTSLAFSSVAHTCRNVQYGWLI
RNLHANGASFFFICIFLHIGRGLYYGSYLYKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGHT
LVEWAWGGFSVDNPTLTRFFALHFLLPFAIAGITIIHLTFLHESGSNNPLGISSDSDKIPFHPYYSFKDILGLTLMLTPF
LTLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAASVLILFLIPFLHKSKQRTMTFRP
LSQTLFWLLVANLLILTWIGSQPVEHPFIIIGQMASLSYFTILLILFPTIGTLENKMLNY
Chains D,Q sequence:
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGEL
FMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGM
APPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPP
K
Chains E,R sequence:
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSD
IPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPC
HGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Chains F,S sequence:
AARATVAGGGRLMDRIRKWYYNAAGFNKYGLMRDDTLYEDDDVKEALKRLPEDLYNERMFRIKRALDLSLKHRILPKEQW
VKYEEDKPYLEPYLKEVIRERLEREAWNKK
Chains G,T sequence:
GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYEND
Q
Chains H,U sequence:
LRGSGEEEEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Chains I,V sequence:
XXXXXXXXXXXXXXXRPLLCRESMSGRSARRDLVAGISLNAPASVRY
Chains J,W sequence:
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COPROTEIN I;
member of: CATH:search3.30.830.10GENE3D:searchG3DSA_3.30.830.10PANTHER:searchPTHR11851/searchPTHR11851_SF116PFAM:searchPF00675/searchPF05193SUPERFAMILY:searchSSF63411UniProt:searchD0VX31
JMol viewer RasMol script viewer  PEE 2008A  ..                                                                                                                                                                                                                                                                                                                                                                                                                                                         *  
sec str:  ....hhhhhh......eeee.....eeeeee....eeeeeeee..hhhhh.....hhhhhhhh.........hhhhhhhhhhh...eeeeee....eeeeeeee..hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh..hhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee..hhhhhhhhhhhhh......hhhhh...........eeeeeee.....eeeeeeee......hhhhhhhhhhhhhheee....hhhhh.hhhhhhhhhh....eeeeeeee....eeeeeeeeehhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeee......hhhhhhhhhh..
sequence :  ..AATYAQTLQNIPETNVTTLDNGLRVASEESSQPTCTVGVWIGAGSRYENEKNNGAGYFVEHLAFKGTKKRPCAAFEKEVESMGAHFNGYTSREQTAFYIKALSKDMPKVVELLADVVQNCALEESQIEKERGVILQELKEMDNDMTNVTFDYLHATAFQGTALARTVEGTTENIKHLTRADLASYIDTHFKAPRMVLAAAGGISHKELVDAARQHFSGVSFTYKEDAVPILPRCRFTGSEIRARDDALPVAHVALAVEGPGWADPDNVVLHVANAIIGRYDRTFGGGKHLSSRLAALAVEHKLCHSFQTFNTSYSDTGLFGFHFVADPLSIDDMMFCAQGEWMRLCTSTTESEVKRAKNHLRSAMVAQLDGTTPVCETIGSHLLNYGRRISLEEWDSRISAVDARMVRDVCSKYIYDKCPALAAVGPIEQLLDYNRIRSGMYWI
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  ||||||   ^*** ||||   |  | | |   |    | |  |||||||||  |  || | | |       |  |||||   | | ||               |  ||  ||  || | ||||||  |  ||  |  |   ^***     | |||||  |   |    |  ||  |  |  ||   |  |        | |||    |  | |   ||||           |  |    |  |            || | |              |  | || |||||       ||||      ^*** |             |  |    |  ||| | ||| |       |   |          |   |       | ||||  ||||||| ||         | || |         |  | | | | || |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  |  ||||||     |  ||||   |  | | |   |    | |  |||||||||  |  || | | |       |  |||||   | | ||               |  ||  ||  || | ||||||  |  ||  |  |            | |||||  |   |    |  ||  |  |  ||   |  |        | |||    |  | |   ||||           |  |    |  |            || | |              |  | || |||||       ||||        |  |             |  |    |  ||| | ||| |       |   |          |   |       | **^*  ||||||| ||         | || |         |  | | | | || |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  ||||||     |  ||||   |  | | |   |    | |  |||||||||  |  || | ^**       |  |||||   | ^**|               |  ||  ||  || | ||||||  |  ||  |  |            | |||||  |   |    |  ||  |  |  ||   |  |        ^**||    |  | |   ^**|           |  |    |  |            || | |              |  | || ||^**       ||||        |  |             |  |    |  ||| | ||| |       |   |          |   |       | || |  ||||||| ||         | || |         |  | | | | || |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  ||||||     ^***|||   |  | | |   |    | ^***||||||||  |  || | | |       |  |||||   | ^***               |  ||  ||  || | ^***||  |  ||  |  |            | |||||  |   |    |  |^***  ^***|   |  |        ^***|    |  | |   ^***           ^***    |  |            || | |              |  | || || |        ||||        ^***             ^***    |  ||| | |^***       |   |          |   |       | || ^***|||||^***         | || |         |  | | | | || |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  ||||||         |^*****  | | |   ^***** |  |||||||||  |  || | | |       |  |||^*****                    |  ||  ||  || |  || ||  |  ||  |  |            | ||^*****   ^*****  |      |   |   |  |        |   |    |  | ^*****                     |  |            || | |              |  | || || |        ||||                                 |  ||| | | |         |   |          |   |       | || |  ||||||| |          | || |         |  | | | | || |  
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  |  ||||||         | |      | | |          |  |||||||||  |  || | | |       |  |||||                        |  ||  ||  || |  || ||  |  ||  |  |            | || ||  |        |  |      |   |   |  |        |   |    |  |                            |  |            || | |              |  | || || |        ||||                                 |  ||| | | |         |   |          |   |       ^*** |  ||||||| |          | || |         |  | | | | || |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  *****|         | |      | | |          |  |||||||||  ***** | | |       |  |||||                        *****  ||  || ********  *****  |  |            | || ||  |        |  |      |   |   |  |        |   |    |  |                            |  |            || | |              |  | || || |        ||||                                 *****| | | |         |   |          |   |       | |  ********|| |          | || |         |  | | | | || |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |||| |         | |      | | |          |  |***|||||  |  |  | | |       |  |||||                        |  ||  ||  || |  |  |   |  |   |  |            | || ||  |        |  |      |   |   |  |        |   |    |  |                            |  |            || ***              |  | || || |        ||||                                 |  | | | | |         |   |          |   |       | |  |  |||| || |          | || |         |  | *** | || |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  **** |         | |      | | |          **** | ****|  ******* | |       |  ****|                        ********|  || *******   ****   ****            ******|  |        |  |      |   |   ****        |   |    |  |                            |  |            ****                **** ****| |        ||||                                 **** | | | |         |   |          |   |       | |  ******* || |          | ****         |  |   | **** |  
search RasMol script viewer Motif-ligand binding stats  nest ..  |   ||  |         ***      | | |          |  | |  |***          | |       |   |***                                |  |***                                |  |  |  |        |  |      |   |   |  |        |   |    |  |                            |  |             | |                |  |  |  | |        ****                                      | | | |         |   |          |   |       ***  |   ||  || |          | || |         |  |   |   |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..  |   |****                  *****          **** ****             | |       |   |                                   ****                                   ****  ****        ****      |   |   ****        |   |    ****                            ****             ***                ****  ******                                                  | | | |         |   |          |   |            |   ||  ****          ******         ****   |   ****  
search RasMol script viewer Motif-ligand binding stats  stmotif ..  *****                      | |                                  | |       |   |                                                                                                      |   |               *****                                                                                                                                      | | | |         |   |          |   |            *****|   |                                  |   |     
search RasMol script viewer Motif-ligand binding stats  ststaple ..  *****                      | |                                  | |       *****                                                                                                      *****                                                                                                                                                          *******         *****          *****                 *****                                  *****     
search RasMol script viewer Motif-ligand binding stats  stturn ..                             ***                                  ***                                                                                                                                                                                                                                                                                                                                                                                       

chain B : MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COPROTEIN 2;
member of: CATH:search3.30.830.10GENE3D:searchG3DSA_3.30.830.10PANTHER:searchPTHR11851/searchPTHR11851_SF119PFAM:searchPF00675/searchPF05193SUPERFAMILY:searchSSF63411UniProt:searchD0VX29
sec str:  ........eee.....eee.......eeeeeeee..hhhhh.....hhhhhhhhh........hhhhhhhhhhh.....eeee....eeeeeeee..hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh..hhhhh....hhhhh...hhhhhhhhhhhhh....eeeeee..hhhhhhhhhhhh...................eeeee....eeeeeeeee.......hhhhhhhhhhhhh............hhhhhhhhhhh...eeeeeeeeee..eeeeeeeeeee..hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh....hhhhhhhhhhh.hhhhhhhhhhhhhhh..eeeeeehhhhh.hhhhh
sequence :  ..GAEDLEITKLPNGLIIASLENFSPASRIGVFIKAGSRYETTANLGTAHLLRLASPLTTKGASSFRITRGIEAVGGSLSVYSTREKMTYCVECLRDHVDTVMEYLLNVTTAPEFRPWEVTDLQPQLKVDKAVAFQSPQVGVLENLHAAAYKTALANPLYCPDYRIGKITSEQLHHFVQNNFTSARMALVGIGVKHSDLKQVAEQFLNIRSGAGTSSAKATYWGGEIREQNGHSLVHAAVVTEGAAVGSAEANAFSVLQHVLGAGPLIKRGSSVTSKLYQGVAKATTQPFDASAFNVNYSDSGLFGFYTISQAAHAGEVIRAAMNQLKAAAQGGVTEEDVTKAKNQLKATYLMSVETAQGLLNEIGSEALLSGTHTAPSVVAQKIDSVTSADVVNAAKKFVSGKKSMAASGDLGSTPFLDEL
seq num:  ..20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           |||   |  | | |          |  ||| |||||     |  |||| | | |    || |||   | |||||       |  |  |  | ||^***  | | |  |||| || |  |||  ||  |    | ||||  |  |     |  || |           ^*** ||   | ||   |       | |   |    | |   | |     | | |        | |  | ||   |           || ||| |||   |    | |         ^***|         |  ||    |  || ||  ||| ||||| ||  ||   |   || |                               |  |     |   | ||       |  | |  | 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..           |||   |  | | |          |  ||| |||||     |  |||| | | |    || |||   | |||||       |  |  |  | ||  ||  | | |  |||| || |  |||  ||  |    | ||||  |  |     |  || |             || ||   | ||   |       | |   |    | |   | |     | | |        | |  | ||   |           |**^*| |||   |    | |          |  |         |  ||    |  || ||  ||| ||||| ||  ||   |   || |                               |  |     |   | ||       |  | |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |||   |  | | |          |  ||| |||||     |  |^** | ^**    || |||   | ^**||       |  |  |  | ||  ||  | | |  |||| || |  |||  ||  |    | ||||  |  |     |  || |             |^**|   | ||   |       | |   |    ^**   | |     | | |        | |  | ||   |           |  | | ^**   |    | |          |  |         |  ||    |  || ||  ||| ||||| ||  ||   |   || |                               |  |     |   ^**|       |  | |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           |||   |  | | |          ^***|| |||||     |  | |  |        || |||   | ^***|       |  |  ^*** ||  |^*** | |  |||| || |  |||  ||  |    | ||||  |  |     |  || |             || ||   | ||   |       | |   |    |     | |     | | |        | |  | ||   |           |  | |  |    |    | |          |  |         |  ||    |  || ||  ||| |^*** ||  ||   |   || |                               ^***     |   |  |       |  | |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |^*****  | | |          |  ||| |||||     |  | |  |        || |^*****  | ||       |  |       ||  ||  | | |  |||| || |  |||  ||  ^***** ||||  |  |     |  || |             || ||   | ^*****       | |   ^*****     | |     | | |        ^***** ||   |           |  ^*****    ^***** |          |  |         |  ||    |  || ||  ||| | ||  ||  ||   |   || |                                        |   |  |       |  | |  | 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..           | |      | | |          |  ||| |||||     |  | |  |        || |||      | ||       |  |       ||  ||  | | |  |||| || |  |||  ||  |    | ||||  |  |     |  || |             || ||   |  |           | |              | |     | | |          |  | ||   |           |  | |  |         | |          |  |         |  ||    |  || ||  ||| | ||  ||  ||   |   || |                                        |   ^***       |  | |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |      | | |          |  ||| |||||     |  | |  |        || |||      | ||       |  |       ||  ||  | | *****|| || *****|  ||  |    *****|  |  |     |  || |             *****   |  |           | |              | |     | | |          |  | ||   |           |  | |  |         | |          |  |         *****    ************| | |*********   |   || |                                        |   |          |  | |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | |      *** |          |  ||| |||||     |  | |  |        || |||      | ||       |  |       ||  ||  | | |  | || || |  | |  ||  |    | || |  |  |     |  || |             || ||   |  |           | |              | |     | | |          |  | ||   |           |  | |  |         | |          |  |         |  |     |  |  ||  | | | ||  ||  |    |   || |                                        |   |          |  | |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |      | | |          |  |*******|     |  | |  |        |****|      | ||       ****       ||  ||  | | **** ***** **** ********    **** |  |  |     |  || |             ****|   |  |           | |              | |     | | |          **** ||   |           **** |  |         | |          ****         ****     *********** | | |********    |   || |                                        |   |          **** **** 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           | |      | | |          |  | |  || |     |  | |  |        |  | |      | ||                  ||  ||  | |                 |  |          |  |  |  |     |  || |              |  |   |  |           ***              | |     | | |          |  | ||   |           |  | |  |         | |                                            | | |   |        |   || |                                        |   |          |  |      
search RasMol script viewer Motif-ligand binding stats  nest ..           ***      *** |          |  | |  |***     |  | |  |        |  ***      | ||                  ||  ||  ***                 |  |          |  |  |  |     |  |***              |  |   |  |                            ***     *** |          |  | ||   |           |  | |  |         | |                                            *** |   |        |   || |                                        |   |          |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..                      | |          **** ****        **** ****        |    |      ****                  ||  ||                      ****          ****  ****     *******              ****   ****                                      ***          **** ||   |           **** ****         ***                                                |   |        |   |***                                        |   |          ****      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                      | |                                            ******      | |                   ||  ||                                                                                                                                         | ||   |                             | |                                                |   |        |   |                                           |   |                    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                      | |                                                        | |                   ******                                                                                                                                         | |*****                             | |                                                *****        *****                                           *****                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                      ***                                                        ***                                                                                                                                                                  ***                                  ***                                                                                                                                      

chain C : CYTOCHROME B
member of: CATH:search1.20.810.10GENE3D:searchG3DSA_1.20.810.10PANTHER:searchPTHR19271PFAM:searchPF00032/searchPF13631PIRSF:searchPIRSF038885PROSITE PROFILES:searchPS51002/searchPS51003, SUPERFAMILY:searchSSF81342/searchSSF81648UniProt:searchP18946
JMol viewer RasMol script viewer  BOG 2010P  ..                                                                                                                                                                                                                                                                                                                                                                                            
JMol viewer RasMol script viewer  BOG 2091D  ..                                                                                                                                                                                                                                                                                                                                                                                            
JMol viewer RasMol script viewer  BOG 2009D  ..                                                                           *                                                                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  CDL 2003D  ..                             *  *                                          |                                                                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  GOL 2011C  ..                             |  |                              *  *        |    *                                                                                                                                                                              **                                                                                                                           
JMol viewer RasMol script viewer  PEE 2007C  ..                             |* |                              |  |        |    |              **      **                                                                                                                                                      ||                   *                                       *        **     *                                               
JMol viewer RasMol script viewer  UQ 2002C  ..                 *   *     * || |  *  *                        |  |        |    |              ||      ||                                                                                            *   *   *              *       *                          ||                   |                                       |        ||     |                                               
JMol viewer RasMol script viewer  JZZ 2001C  ..                 |   |     | || |  |  |                        |  |        |    |              ||      ||                   *   *  **     *   **  *                                                  |   |   |              |       |                          ||           **** ** | *               *                     |        ||     |                                               
JMol viewer RasMol script viewer  HEM 502C  ..                 |   |     | ||****                        |  |        |    |              ||** *  || *     **  ** *    |   |  ||     |   ||  |                                              *  **  *|   **             |       |                          ||           |||| || | |               |                     |        ||     |                                               
JMol viewer RasMol script viewer  HEM 501C  ..                 |   |     | |||| || ||     **  ** **          |  |        |    *  *           |||| |  || |     ||  || |   ** | **|**   |   ||  |                                   **  *      |  ||  ||   ||             |       |                          ||           |||| || | |               |                     |        ||     |                                               
JMol viewer RasMol script viewer  PEE 2008A  ..                 |   |     | |||| || ||     ||  || ||          |  |        |    |  |           |||| |  || |     ||  || |   || | | |||||   |   ||  |                                   ||  |      |  ||  ||   ||             |*      |*                         ||           |||| || | |               |                     |        ||     |                                               
sec str:  .....hhhhhh.hhhhhhhhhh..eee...hhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh..hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............eeehhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh.............hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..MAPNIRKSHPLLKMINNSLIDLPAPSNISAWWNFGSLLAVCLMTQILTGLLLAMHYTADTSLAFSSVAHTCRNVQYGWLIRNLHANGASFFFICIFLHIGRGLYYGSYLYKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGHTLVEWAWGGFSVDNPTLTRFFALHFLLPFAIAGITIIHLTFLHESGSNNPLGISSDSDKIPFHPYYSFKDILGLTLMLTPFLTLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAASVLILFLIPFLHKSKQRTMTFRPLSQTLFWLLVANLLILTWIGSQPVEHPFIIIGQMASLSYFTILLILFPTIGTLENKMLNY
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          |  ||^***|||  | ^***| | |    |   |   ||   || |  |  ||  |   ||| | |||                     | ||||||| | |   |                           |   | || ||| |  |  |  | |   |  ||             | | |||   |  |      | | | ||| | |   | ||                   |  || |  |  |  |       || ||  || |  |    | |  ||        || || | |   | |             |   ||| ||         | |  ||  |   |   | |   || |||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          |  ||  | |||  |  |||| | |    |   |   ||   || |  |  ||  |   ^** | |||                     | ||||||| | |   |                           |   | || ||| |  |  |  | |   |  ||             | | |||   |  |      | | | ^** | |   ^**|                   |  || |  |  |  |       || ||  || |  |    | |  ||        || || | |   ^**             |   ||| ||         | |  ||  |   |   | |   || |||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  ||  ^***|  |  |||| | |    |   |   ||   || |  |  ||  |   ||  | |||                     | ||||||| | |   |                           |   | || ||| |  ^***  | |   |  ||             | | |||   |  |      | | ^***  | |   ^***                   |  || |  |  |  |       || ||  || |  |    | |  ||        || || | |                   |   ||| ||         | |  ||  |   |   | |   || |||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          |  ||  | | |  |  |||| | ^*****   |   |^***** |  |  ||  |   ||  | |||                     | ^*****| | |   |                           |   | || ||| |        | |   |  ||             | | |||   |  |      | |       | |                          |  || |  |  |  |       || ||  || |  |    ^*****|        || || | |                   |   ||| ||         ^*****|  |   |   | ^***** |||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          *****  | | |  |  |||| |      |   |   |    |  |  *****  |   ||  | |||                     *****|||| | |   |                           |   | || ||| |        | |   *****             | *****   |  |      | |       | |                          |  || |  |  |  |       ********* |  |      *****        || || | |                   |   ||| ||           |  ||  |   |   |     || |||
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  |   | | |  |  |||| |      |   |   |    |  |  |  |   |   ||  | |||                     |  | |||| | |   |                           |   | || ||| |        | |   |  |              | | ||    |  |      | |       | |                          |  |***  |  |  |       || ||  |  |  |      |  |         || || | |                   |   ||| ||           |  ||  |   |   |     || |||
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ****   | | |  |  ||****      |   |   |    |  |  ****   |   ||  ****|                     **** ||**** |   |                           |   | ****|| |        | |   ****              | ****    ****      | |       | |                          ****  |  |  |  |       ********  |  |      ****         ****| | |                   |   |*****           |  ||  |   |   |     |****|
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             |   | | |  |  || |        |   |   |    |  |         |   ||  | | |                          ||||   |   |                           |   |  |  |***        | |                     |   |               | |       | |                          |  |  |  |  |  |                 |  |                    |  | | |                   |   | |  |           |  ||  |   |   |     |  | |
search RasMol script viewer Motif-ligand binding stats  nest ..             |   | | |  |  || |        |   |   |    |  |         |   ||  | ***                          ****   |   |                           |   |  |  |           ***                     |   |               ***       | |                          |  |  |  |  |  |                 |  |                    |  | | |                   |   | |  |           |  ||  |   |   |     |  ***
search RasMol script viewer Motif-ligand binding stats  niche ..             |   | ***  ****| |        |   |   |    ****         |   |****                                     |   |                           |   |  ****                                   |   |                         ***                          ****  ****  ****                 ****                    ****** |                   |   | ****           |  ||  |   |   |     |    |
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..             |   |          | |        |   |   |                 |   |                                         |   |                           |   |                                         |   |                                                                                                                    | |                   |   |                |  ||  |   |   |     ******
search RasMol script viewer Motif-ligand binding stats  ststaple ..             *****          | |        *********                 *****                                         *****                           *****                                         *****                                                                                                                    | |                   *****                ********   *****           
search RasMol script viewer Motif-ligand binding stats  stturn ..                            ***                                                                                                                                                                                                                                                                                       ***                                                                   

chain D : MITOCHONDRIAL CYTOCHROME C1, HEME PROTEIN
member of: CATH:search1.10.760.10/search1.20.5.100GENE3D:searchG3DSA_1.10.760.10/searchG3DSA_1.20.5.100PANTHER:searchPTHR10266PFAM:searchPF02167PRINTS:searchCYTOCHROMEC1PROSITE PROFILES:searchPS51007, SUPERFAMILY:searchSSF46626/searchSSF81496UniProt:searchD0VX26
JMol viewer RasMol script viewer  BOG 2091D  ..                                                                                                                                                                                                       *  *                                      
JMol viewer RasMol script viewer  BOG 2009D  ..                                                                                                                                                                                                       *  **  *                                  
JMol viewer RasMol script viewer  CDL 2003D  ..                                                                                                                                                                                                       |  ||  |            *  **                 
JMol viewer RasMol script viewer  HEC 501D  ..                                   **  **                                                               *  * **    *   *     *                          *    ***  **                                   |  ||  |            |  ||                 
JMol viewer RasMol script viewer  GOL 2011C  ..                                   ||  ||                                                               |  | ||    |   |     |                          |    |||  ||                                   |  ||  |            |  ||                 
sec str:  .......................hhhhhhhhhhhhhhhhhhh......hhhhhh....hhhhhhhhhhh.eeee........eeee............hhhhhhhh..........hhhhhh..hhhhhhhhhh...............ee.......ee...................hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeee....
sequence :  ..GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..            | ||  || |  ^**|  || |   |  | |  | || |||||| |      |  |      | |||      |  |       |   ||  |      | | || ||| |  ||   |  |   |  |  |  |  | || |    |    | |||   |||| ||               |  |              |   |         |  ||^**       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..            | ||  ^***     |  || |   |  | |  | || ||||^***      |  |      | |||      |  |       |   ||  |      | | || ||| |  ||   |  |   |  |  |  |  | || |    |    | |||   |||| ||               |  |              |   |         |  || |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            | ^*****       |  || |   |  | |  | || ||^*****      |  |      | |||      |  |       |   ||  |      | | || ||| |  ||   |  |   |  |  |  |  | || ^*****    | |||   |^*****               |  |              |   |         |  || |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            |  |  |        ***** |   |  | |  | || ||||||        |  |      | |||      |  |       |   ||  |      | | || ||| *****   |  |   |  |  |  |  | ||           | |||   | || |                |  |              |   |         ***** |        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..            |  |  |        |  |  |   |  | |  | || ||||||        |  |      | |||      |  |       *****|  |      | | || ||| |  |    |  |   |  |  |  |  | ||           | |||   | || |                |  |              |   |         |  |  |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..            |  |  |        |  |  |   |  | |  | || ||||||        |  |      | |||      |  |            |  |      *** || ||| |  |    |  |   |  |  |  |  ***|           | |||   | || |                |  |              |   |         |  |  |        
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..            |  |  |        |  |  |   |  | |  | || ||||||        |  |      *****      |  |            |  |          || ||| |  |    |  |   |  |  |  |  |  |           | |||   | || |                |  |              |   |         |  |  |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |  ****        ****  |   |  | |  | *******||        |  |      ****|      |  |            ****          ****|| ****    |  |   ****  ****  |  |           ****|   | || |                ****              |   |         ****  |        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            |  |  |              |   |  | |  |  |  || ||        |  |        | |      |  |                           |  || |       |  |   |  |  |  |  |  |             | |   | |***                                  |   |            |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..            |  |  |              |   |  | |  |  |  |***|        |  |        ***      |  |                           |  || |       |  |   |  |  |  |  |  |             ***   ***                                     |   |            |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..            *******              |   **** ****  ********        ****                 ****                           *******       ****   ****  ****  ****                                                           |   |            ****        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                 *****                                                                                                                                                                              *****                        

chain F : MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE 14PROTEIN;
member of: CATH:search1.10.1090.10GENE3D:searchG3DSA_1.10.1090.10PANTHER:searchPTHR12022PFAM:searchPF02271PIRSF:searchPIRSF000022PRODOM:searchPD008153SUPERFAMILY:searchSSF81524UniProt:searchD0VX30
JMol viewer RasMol script viewer  CDL 2003D  ..                                                              **                                     
JMol viewer RasMol script viewer  PEE 2007C  ..                   *                                          ||                                     
sec str:  ...hhhhhhhhhhhhhhhhhhhh.hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh.hhhhh...hhhhhhhhhhhhhhhhhhh..
sequence :  ..GRLMDRIRKWYYNAAGFNKYGLMRDDTLYEDDDVKEALKRLPEDLYNERMFRIKRALDLSLKHRILPKEQWVKYEEDKPYLEPYLKEVIRERLEREAWNKK
seq num:  ..10        20        30        40        50        60        70        80        90        100        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..              |||| ||||||||| |     | || |    |             ^**||   |  | || ||  |                     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              |||| |||||||^***     | || |    |             | |||   |  | || ||  |                     
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..              |||| |||||||||       | |*******^             | |||   |  | *******^                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..              ||*****|*****|       **** |                  ****|   |  | ****|                        
search RasMol script viewer Motif-ligand binding stats  nest ..              **** ***  |  |         |  |                    ***   |  |  |  |                        
search RasMol script viewer Motif-ligand binding stats  niche ..                        ****         ****                          ****  ****                        

chain H : MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE 11PROTEIN, COMPLEX III SUBUNIT VIII;
member of: CATH:search1.10.287.20GENE3D:searchG3DSA_1.10.287.20PANTHER:searchPTHR15336PFAM:searchPF02320PIRSF:searchPIRSF000019SUPERFAMILY:searchSSF81531UniProt:searchD0VX28
sec str:  ........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
seq num:  ..9         19        29        39        49        59        69        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          ^**|    ^**           || |^**| |||                |  |||  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          ^***                  || ||||^***|                |  |||  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                                || ||||  | |                *****|  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                || ||||  | |                **** |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..                                || ****  ***                     **** 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                ******                                

chain I : CYTOCHROME B-C1 COMPLEX SUBUNIT RIESKE, MITOCHOND
member of: CATH:search2.10.210.10GENE3D:searchG3DSA_2.10.210.10PANTHER:searchPTHR10134/searchPTHR10134_SF4PFAM:searchPF09165SUPERFAMILY:searchSSF56568UniProt:searchQ5ZLR5
sec str:  .....................hhhhhh........eeeee.....eee
sequence :  ..XXXXXXXXXXXXXXXRPLLCRESMSGRSARRDLVAGISLNAPASVR
seq num:  ..28        38        52        62        72    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                 | | | |^**^**     | |  |  ^**
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                 | | | |||||       ^*****     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 | | | ****|         |  |     
search RasMol script viewer Motif-ligand binding stats  nest ..                 | | |  |***         |  |     
search RasMol script viewer Motif-ligand binding stats  niche ..                 *** *******         ****     

chain P : CYTOCHROME B
member of: CATH:search1.20.810.10GENE3D:searchG3DSA_1.20.810.10PANTHER:searchPTHR19271PFAM:searchPF00032/searchPF13631PIRSF:searchPIRSF038885PROSITE PROFILES:searchPS51002/searchPS51003, SUPERFAMILY:searchSSF81342/searchSSF81648UniProt:searchP18946
JMol viewer RasMol script viewer  BOG 3091Q  ..                                                                                                                                                                                                                                                                                                                                                                                           
JMol viewer RasMol script viewer  BOG 3009Q  ..                                                                                                                                                                                                                                                                                                                                                                                           
JMol viewer RasMol script viewer  CDL 3003Q  ..                            *                                                                                                                                                                                                         *                                                                                                                                                    
JMol viewer RasMol script viewer  GOL 3011P  ..                            |                                 *                                                                      *                                                                                                |                       *                                                                                                                            
JMol viewer RasMol script viewer  PEE 3008P  ..                            |                                 |                                                                      |                                                                                      *         |                       |                                                                                                                            
JMol viewer RasMol script viewer  PEE 3007P  ..                            |*                                |                               **      **                             |                                                                                      |         |                       |                    *                                       *        **     *                                               
JMol viewer RasMol script viewer  UQ 3002P  ..                    * *   * ||    *  *   *                    |                               ||      ||                             |                                                              *  **   *              *|      *  |                       |                    |                                       |        ||     |                                               
JMol viewer RasMol script viewer  JZZ 3001P  ..                    | |   | ||    |  |   |                    |                               ||      ||                   *   *  ** |   *   *   *                                                  |  ||   |              ||      |  |                       |            **** ** | *               *                     |        ||     |                                               
JMol viewer RasMol script viewer  BOG 2010P  ..            *       | |   | ||    |  |   |                    |                               ||      ||                   |   |  || |   |   |   |                                                  ** |*   |              ||      |  |                       |            |||| || | |               |                     |        ||     |                                               
JMol viewer RasMol script viewer  HEM 502P  ..            |       | |   | ||*  ***   |                    |                               ||** *  || *     **  ** *    |   |  || |   |   |   |                                                 ***|   **             ||      |  |                       |            |||| || | |               |                     |        ||     |                                               
JMol viewer RasMol script viewer  HEM 501P  ..            |       | |   | |||  || ||   | **  ** **          |                *  *           |||| |  || |     ||  || |   *****|*|   |   |   |                                   **  *  *      ||| ||   ||             ||      |  |                       |            |||| || | |               |                     |        ||     |                                               
sec str:  ....hhhhhh.hhhhhhhhhh..eee...hhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh..hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............eeehhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh.............hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...
sequence :  ..APNIRKSHPLLKMINNSLIDLPAPSNISAWWNFGSLLAVCLMTQILTGLLLAMHYTADTSLAFSSVAHTCRNVQYGWLIRNLHANGASFFFICIFLHIGRGLYYGSYLYKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLFSAIPYIGHTLVEWAWGGFSVDNPTLTRFFALHFLLPFAIAGITIIHLTFLHESGSNNPLGISSDSDKIPFHPYYSFKDILGLTLMLTPFLTLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAASVLILFLIPFLHKSKQRTMTFRPLSQTLFWLLVANLLILTWIGSQPVEHPFIIIGQMASLSYFTILLILFPTIGTLENKMLNY
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         |  ||^***|||  | ^***| | |    |   |   ||   || |  |  ||  |   ||| | |||                     | ||||||| | |   |      |   |             |  ||  | || ||     |  |  | |   |  ||             |   |     |  |      | | | ||| | |   | ||                    | || |  |  | ||       || ||  || |  |    |    |         || || | |   | |             |   ||| ||         | |  ||  |   |   | |   || |||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  ||  | |||  |  |||| | |    |   |   ||   || |  |  ||  |   ^** | |||                     | ||||||| | |   |      |   |             |  ||  | || ||     |  |  | |   |  ||             |   |     |  |      | | | ^** | |   ^**|                    | || |  |  | ||       || ||  || |  |    |    |         || || | |   ^**             |   ||| ||         | |  ||  |   |   | |   || |||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  ||  ^***|  |  |||| | |    |   |   ||   || |  |  ||  |   ||  | |||                     | ||||||| | |   |      |   |             |  ||  | || ||     ^***  | |   |  ||             |   |     |  |      | | ^***  | |   ^***                    | || |  |  | ||       || ||  || |  |    |    |         || || | |                   |   ||| ||         | |  ||  |   |   | |   || |||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  ||  | | |  |  |||| | ^*****   |   |^***** |  |  ||  |   ||  | |||                     | ^*****| | |   |      |   |             |  ||  | || ||           | |   |  ||             |   |     |  |      | |       | |                           | || |  |  | ||       || ||  || |  |    ^*****         || || | |                   |   ||| ||         ^*****|  |   |   | ^***** |||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         *****  | | |  |  |||| |      |   |   |    |  |  *****  |   ||  | |||                     *****|||| | |   |      |   |             |  ||  | || ||           | |   *****             |   |     |  |      | |       | |                           | || |  |  | ||       ********* |  |                   || || | |                   |   ||| ||           |  ||  |   |   |     || |||
search RasMol script viewer Motif-ligand binding stats  asxturn ..         |  |   | | |  |  |||| |      |   |   |    |  |  |  |   |   ||  | |||                     |  | |||| | |   |      |   |             |  ||  | || ||           | |   |  |              |   |     |  |      | |       | |                           | |***  |  ***|       || ||  |  |  |                   || || | |                   |   ||| ||           |  ||  |   |   |     || |||
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****   | | |  |  ||****      |   |   |    |  |  ****   |   ||  ****|                     **** ||**** |   |      |   |             |  ||  | *****           | |   ****              |   |     ****      | |       | |                           | |  |  |  |  |       ********  |  |                   ****| | |                   |   |*****           |  ||  |   |   |     |****|
search RasMol script viewer Motif-ligand binding stats  nest ..            |   | | |  |  || |        |   |   |    |  |         |   ||  | ***                          ****   |   |      |   |             |  ||  |  |  |           ***                     |   |               ***       | |                           | |  |  |  |  |                 |  |                    |  | | |                   |   | |  |           |  ||  |   |   |     |  ***
search RasMol script viewer Motif-ligand binding stats  niche ..            |   | ***  ****| |        |   |   |    ****         |   |****                                     |   |      |   |             |  ||  |  ****                                   |   |                         ***                           ***  ****  ****                 ****                    ****** |                   |   | ****           |  ||  |   |   |     |    |
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..            |   |          | |        |   |   |                 |   |                                         |   |      |   |             |  ||  |                                         |   |                                                                                                                    | |                   |   |                |  ||  |   |   |     ******
search RasMol script viewer Motif-ligand binding stats  ststaple ..            *****          | |        *********                 *****                                         *****      *****             ********                                         *****                                                                                                                    | |                   *****                ********   *****           
search RasMol script viewer Motif-ligand binding stats  stturn ..                           ***                                                                                                                                                                                                                                                                                       ***                                                                   

chain Q : MITOCHONDRIAL CYTOCHROME C1, HEME PROTEIN
member of: CATH:search1.10.760.10/search1.20.5.100GENE3D:searchG3DSA_1.10.760.10/searchG3DSA_1.20.5.100PANTHER:searchPTHR10266PFAM:searchPF02167PRINTS:searchCYTOCHROMEC1PROSITE PROFILES:searchPS51007, SUPERFAMILY:searchSSF46626/searchSSF81496UniProt:searchD0VX26
JMol viewer RasMol script viewer  BOG 3091Q  ..                                                                                                                                                                                                       *                                         
JMol viewer RasMol script viewer  BOG 3009Q  ..                                                                                                                                                                                                       |  **  **                                 
JMol viewer RasMol script viewer  CDL 3003Q  ..                                                                                                                                                                                                       |  ||  ||           *  **                 
JMol viewer RasMol script viewer  HEC 501Q  ..                                   **  **                                                               *  * **        *     *                          *    ***  **                                   |  ||  ||           |  ||                 
JMol viewer RasMol script viewer  GOL 3011P  ..                                   ||  ||                                                               |  | ||        |     |                          |    |||  ||                                   |  ||  ||           |  ||                 
sec str:  .......................hhhhhhhhhhhhhhhhhhh......hhhhhh....hhhhhhhhhhh.eeee........eeee............hhhhhhhh..........hhhhhh..hhhhhhhhhh...............ee.......ee...................hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeee....
sequence :  ..GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..            | ||  || |  ^**      |   |  | |  |  | |||||| |      |  |      | |||      |  |       |   ||  | |    | | || ||    |   | |  |   |  |  |  |  | || |  | |    | |||   |||| ||               |  |             ||  ||         || ||^**       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..            | ||  ^***           |   |  | |  |  | ||||^***      |  |      | |||      |  |       |   ||  | |    | | || ||    |   | |  |   |  |  |  |  | || |  | |    | |||   |||| ||               |  |             ||  ||         || ||||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            | ^*****             |   |  | |  |  | ||^*****      |  |      | |||      |  |       |   ||  | |    | | || ||    |   | |  |   |  |  |  |  | || ^*****    | |||   |^*****               |  |             ||  ||         || ||||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            |  |  |              |   |  | |  |  | ||||||        |  |      | |||      |  |       |   ||  | |    | | || ||    |   | |  |   |  |  |  |  | ||    | |    | |||   | || |                |  |             ||  ||         *****||        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..            |  |  |              |   |  | |  |  | ||||||        |  |      | |||      |  |       *****|  | |    | | || ||    |   | |  |   |  |  |  |  | ||    | |    | |||   | || |                |  |             ||  ||         || | ||        
search RasMol script viewer Motif-ligand binding stats  asxturn ..            |  |  |              |   |  | |  |  | ||||||        |  |      | |||      |  |            |  | |    *** || ||    |   | |  |   |  |  |  |  ***|    | |    | |||   | || |                |  |             ||  ||         || | ||        
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..            |  |  |              |   |  | |  |  | ||||||        |  |      *****      |  |            |  | |        || ||    |   | |  |   |  |  |  |  |  |    | |    | |||   | || |                |  |             ||  ||         || | ||        
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |  ****              |   |  | |  |  | ****||        |  |      ****|      |  |            **** |        ****|    |   | |  |   ****  ****  |  |    | |    ****|   | || |                ****             ||  ||         **** ||        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            |  |  |              |   |  | |  |  |  || ||        |  |        | |      |  |               | |         |  |    |   | |  |   |  |  |  |  |  |    | |      | |   | |***                                 ||  ||          | | ||        
search RasMol script viewer Motif-ligand binding stats  nest ..            |  |  |              |   |  | |  |  |  |***|        |  |        ***      |  |               ***         |  |    |   | |  |   |  |  |  |  |  |    | |      ***   ***                                    ||  ||          | | ||        
search RasMol script viewer Motif-ligand binding stats  niche ..            *******              |   **** ****  ********        ****                 ****                           ****    |   | ****   ****  ****  ****    ***                                                   ||  ||          | ****        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                 *****                                                                                      *****                                                                                  ******          *****         

   New search    3l73:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors