triangle PDBeMotif: 3l32  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification viral protein    | release date: Wed, Dec 16, 2009
Title structure of the dimerisation domain of the rabies virus phosphoprotein
Authors I.IVANOV, M.JAMIN, R.W.H.RUIGROK, T.CREPIN
Method X-RAY DIFFRACTION (resolution: 1.50Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MNLLFQSYLDNVGVQIVRQMRSGERFLKIWSQTVEEIVSYVTVNF
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PHOSPHOPROTEIN
member of: PFAM:searchPF03012PRODOM:searchPD004155UniProt:searchQ0GBY3
sec str:  ..hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh
sequence :  ..NLLFQSYLDNVGVQIVRQMRSGERFLKIWSQTVEEIVSYVTVNF
seq num:  ..90        100       110       120       130 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..||  |^***        |  | |        ^***         
search RasMol script viewer Motif-ligand binding stats  asxmotif ..*****|           |  | |                     
search RasMol script viewer Motif-ligand binding stats  betaturn .. |   |           **** |                     
search RasMol script viewer Motif-ligand binding stats  nest .. |   |              ***                     
search RasMol script viewer Motif-ligand binding stats  ststaple .. *****                                      

chain B : PHOSPHOPROTEIN
member of: PFAM:searchPF03012PRODOM:searchPD004155UniProt:searchQ0GBY3
sec str:  ...hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh
sequence :  ..MNLLFQSYLDNVGVQIVRQMRSGERFLKIWSQTVEEIVSYVTVNF
seq num:  ..89        99        109       119       129  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      ^***        || |||        ^***         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                  |****|                     
search RasMol script viewer Motif-ligand binding stats  nest ..                  |  ***                     
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                  ******                     

   New search    3l32:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors