triangle PDBeMotif: 3kvh  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Download structure factors file
Classification rna binding protein    | release date: Mon, Nov 30, 2009
Title crystal structure of human protein syndesmos (nudt16-like pr
Authors A.FLORES, A.G.THORSELL, A.JOHANSSON, A.K, A.K.ROOS, A.KALLAS, A.M.EDWARDS, C.BOUNTRA, C.H.ARROWSMITH, C.PERSSON, H., H.BERGLUND, I.JOHANSSON, J.WEIGELT, L.TRESAUGUES, M.HAMMAR, M.I.SIPONEN, M.MOCHE, M.WELIN, M.WI, P.KRAULIS, P.NORDLUND, P.SCHUTZ, R.COLLINS, S.FLODIN, S.GRASLUND, S.VAN DEN BERG, STRUCTURAL GENOMICS CONSORTIUM (SGC), T.K.NIELSEN, T.KARLBERG, T.KOTENYOVA, T.NYMAN
Method X-RAY DIFFRACTION (resolution: 1.70Å)
PDBe Citation   
Small molecules:    search GOL GOL binding statistics GOL   search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRRFWSLEDGLNRVLGL
GLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNA
FVSTAKCQLLFALKVLNMMPEEKLVEALAAATEKQKKALEKLLPASSAHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN SYNDESMOS
JMol viewer RasMol script viewer  CL 219A  ..                                  **                                          ..             ..                                           **                                                        
JMol viewer RasMol script viewer  GOL 1A  ..                                  ||                                          ..             ..                                           ||                      *             **  *               
sec str:  ....eehhhhhh......eeeeeeeeeeeeeeeehhheeeeeeeeeeee....ee..eeee.....hhhhhhhhh.........hhh.eeeeee....eeeeeeeee.hhhhhhhhhhhhhh.......eeeeeee..........hhhhhhh.....hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..LKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRRFWSLEDGLNRVLGLGL..RLTEADYLSSHLT..RVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVEALAAATEKQKKALEKLL
seq num:  ..9         19        29        39        49        59        69        79      ..90           ..107       117       127       137       147       157       167       177       187       197        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..    |  || |||  |           | |    |             | |         |  ||  ||  |||||||..| || ||||    ..           |   |      |  |  |          | |^**||||   || ||  | ^**         ||||        |   ^**         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..    ^***| |||  |           | |    |             | |         |  |^***|  |||||||..| ^***|||    ..           |   |      |  |  |          | |^***|||   || ||  | |||         ||||        |   |           
search RasMol script viewer Motif-ligand binding stats  PS00007 ..       || |||  |           | |    |             | |         |  |    |  |||||||..******^||    ..           |   |      |  |  |          | |   ||||   || ||  | |||         ||||        |   |           
search RasMol script viewer Motif-ligand binding stats  PS00008 ..       || |||  |           | ^*****             | |         |  |    |  |||^***..  || ||||    ..           |   |      |  |  |          | |   |||^***** ||  | |||         ||||        |   |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       || |||  |           | |                  | |         |  |    *****|||||..  || ||||    ..           |   |      |  |  |          | |   ||||   || ||  | |||         ||||        |   |           
search RasMol script viewer Motif-ligand binding stats  asxturn ..       || |||  |           ***                  | |         |  |    |  | |||||..  || ||||    ..           |   |      |  |  |          | |   ||||   || ||  | |||         ||||        |   |           
search RasMol script viewer Motif-ligand binding stats  betabulge ..       || |||  |           | |                  | |         |  |    |  | |||||..  || ||**    ..           |   |      |  |  |          | |   ||||   || ||  | |||         ||||        |   |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****||  |           | |                  | |         |  |    **** |||||..  ****|      ..           |   |      ****  |          | |   ||||   ****|  ****|         ||||        |   |           
search RasMol script viewer Motif-ligand binding stats  nest ..        |  ||  |           | |                  ***         |  |         *****..   |  |      ..           |   |      |  |  |          | |   ****    |  |    ***         ****        |   |           
search RasMol script viewer Motif-ligand binding stats  niche ..        ********           ***                              ****              ..   ****      ..           |   |      *******          ***           ****                            |   |           
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                              ..             ..           *****                                                                     |   |           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                              ..             ..                                                                                     *****           

   New search    3kvh:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML  |  Structure factors