triangle PDBeMotif: 3kqg  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification immune system    | release date: Tue, Nov 17, 2009
Title trimeric structure of langerin
Authors A.S.POWLESLAND, H.FEINBERG, M.E.TAYLOR, W.I.WEIS
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Small molecules:    search CA CA binding statistics CA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D,E,F sequence:
ASTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSR
NSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAW
NDAPCDKTFLFICKRPYVPSEP
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : C-TYPE LECTIN DOMAIN FAMILY 4 MEMBER K
member of: CATH:search3.10.100.10GENE3D:searchG3DSA_1.20.1170.10/searchG3DSA_3.10.100.10PANTHER:searchPTHR22802/searchPTHR22802_SF14PFAM:searchPF00059PROSITE PATTERNS:searchPS00615, PROSITE PROFILES:searchPS50041, SMART:searchSM00034SUPERFAMILY:searchSSF56436UniProt:searchQ9UJ71
JMol viewer RasMol script viewer  CA 400A  ..                                                                                                                              * *     *             **                   
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eee..eeeee.....hhhhhhhhhhhh..ee....hhhhhhhhhhhhh...eeeeeee......eee......hhhhhh................eeee.......eeee......eeeeeee.....
sequence :  ..SDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSE
seq num:  ..159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |             |   ^***             | |                       |  | |      |  || |   || |    ||| | |  |  || |||      ||||||  | | | | | |        | |   || |     |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |             |    |               | |                       |  | |      |  || |   || |    ||| | |  |  || |||      ^**|||  | | | | | |        | |   || |     |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***             |    |               | |                       |  | |      ^***| |   || |    ||| | |  |  ^***||      || |||  | | | | | |        | |   || |     |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                 ^*****               | |                       |  | |      |   | |   || |    |^*****  |   | |||      || |||  | | | | | |        | |   || |     |        
search RasMol script viewer Motif-ligand binding stats  C_TYPE_LECTIN_1 ..                                      | |                       |  | |      |   | |   || |    | | | |  |   | |||      || |||  | | | | | ^***************^*******^        
search RasMol script viewer Motif-ligand binding stats  asxturn ..                                      | |                       |  | |      |   | |   || |    | | | |  |   | ***      || |||  | | | | |          | |   |  |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                      | |                       **** |      |   | |   || |    | | | |  |   ****|      ****||  | | | | |          | |   |  |              
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                      | |                          | |      |   | |   || |    | | ***  |     | |       |  ||  | | | | |          | |   |  |              
search RasMol script viewer Motif-ligand binding stats  nest ..                                      ***                          ***      |   | |   |***    | |   |  |     ***       |  ||  | *** ***          | |   |  |              
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                            |   | |   |       ***   ****               ********     ***          ***   ****              
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                            ***** |   |                                                                                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                  *****                                                                                  

chain B : C-TYPE LECTIN DOMAIN FAMILY 4 MEMBER K
member of: CATH:search3.10.100.10GENE3D:searchG3DSA_1.20.1170.10/searchG3DSA_3.10.100.10PANTHER:searchPTHR22802/searchPTHR22802_SF14PFAM:searchPF00059PROSITE PATTERNS:searchPS00615, PROSITE PROFILES:searchPS50041, SMART:searchSM00034SUPERFAMILY:searchSSF56436UniProt:searchQ9UJ71
JMol viewer RasMol script viewer  CA 400B  ..                                                                                             ..                       * *     *             **                 
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eee..eeeee.....hhhhhhhhhhh...ee....hhhhhhhhhhhhh...eeeeeeee....eeee......hhhhhh.........hhhhh..eeee.......eeee......eeeeeee...
sequence :  ..LNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAG..GDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVP
seq num:  ..167       177       187       197       207       217       227       237       247          ..262       272       282       292       302       312       322 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  |    |   ^***        | | || |                       |  | |      |  || |   || |    |||   |..   |  | |      ||||||  | ||| | | |        | |   || |     |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |    |    |          | | || |                       |  | |      |  || |   || |    |||   |..   |  | |      ^**|||  | ||| | | |        | |   || |     |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  |    |    |          | | || |                       |  | |      ^***| |   || |    |||   |..   ^*** |      || |||  | ||| | | |        | |   || |     |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |    ^*****          | | || |                       |  | |      |   | |   || |    |^*****..      | |      || |||  | ||| | | |        | |   || |     |      
search RasMol script viewer Motif-ligand binding stats  C_TYPE_LECTIN_1 .. |  |                    | | || |                       |  | |      |   | |   || |    | |    ..      | |      || |||  | ||| | | ^***************^*******^      
search RasMol script viewer Motif-ligand binding stats  asxturn .. |  |                    | | || |                       |  | |      |   | |   || |    | |    ..      ***      || |||  | ||| | |          | |   |  |            
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****                    | **** |                       **** |      |   | |   || |    | |    ..      | |      ****||  | |**** |          | |   |  |            
search RasMol script viewer Motif-ligand binding stats  nest ..                         |   |***                          ***      |   | |   |***    | |    ..      ***       |  ||  | *** ***          | |   |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..                         |   |                                      |   | |   |       ***    ..                ********                  ***   ****            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                         |   |                                      ***** |   |              ..                                                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         *****                                            *****              ..                                                                

chain C : C-TYPE LECTIN DOMAIN FAMILY 4 MEMBER K
member of: CATH:search3.10.100.10GENE3D:searchG3DSA_1.20.1170.10/searchG3DSA_3.10.100.10PANTHER:searchPTHR22802/searchPTHR22802_SF14PFAM:searchPF00059PROSITE PATTERNS:searchPS00615, PROSITE PROFILES:searchPS50041, SMART:searchSM00034SUPERFAMILY:searchSSF56436UniProt:searchQ9UJ71
JMol viewer RasMol script viewer  CA 400C  ..                                                                                                                      * *     *             **                 
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eee..eeeee.....hhhhhhhhhhhh..ee....hhhhhhhhhhhhh...eeeeeeee....eeee......hhhhhhhhh......hhhhh..eeee.......eeee......eeeeeee...
sequence :  ..LNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVP
seq num:  ..167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         |   ^***          |  | |                       || |||      |  || |   || |    |||   | | | || |||  |   ||||||  | ||| | | |        | |   || |     |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |    |            |  | |                       || |||      |  || |   || |    |||   | | | || |||  |   ^**|||  | ||| | | |        | |   || |     |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |    |            |  | |                       || |||      ^***| |   || |    |||   | | | ^***||  |   || |||  | ||| | | |        | |   || |     |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         ^*****            |  | |                       || |||      |   | |   || |    |^***** | |  | |||  |   || |||  | ||| | | |        | |   || |     |      
search RasMol script viewer Motif-ligand binding stats  C_TYPE_LECTIN_1 ..                           |  | |                       || |||      |   | |   || |    | |     | |  | |||  |   || |||  | ||| | | ^***************^*******^      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                           |  | |                       || |||      |   | |   || |    | |     | |  | |||  *****| |||  | ||| | |          | |   |  |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                           **** |                       *****|      |   | |   || |    | |     | |  ****|      ****|**** |**** |          | |   |  |            
search RasMol script viewer Motif-ligand binding stats  nest ..                              ***                       |  ***      |   | |   |***    | |     ***    ***       |  ||  | *** ***          | |   |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..                                                        |    |      |   | |   |       ***                      ********                  ***   ****            
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                        ******      |   | |   |                                                                                
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                    ***** |   |                                                                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                          *****                                                                                

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : C-TYPE LECTIN DOMAIN FAMILY 4 MEMBER K
member of: CATH:search3.10.100.10GENE3D:searchG3DSA_1.20.1170.10/searchG3DSA_3.10.100.10PANTHER:searchPTHR22802/searchPTHR22802_SF14PFAM:searchPF00059PROSITE PATTERNS:searchPS00615, PROSITE PROFILES:searchPS50041, SMART:searchSM00034SUPERFAMILY:searchSSF56436UniProt:searchQ9UJ71
JMol viewer RasMol script viewer  CA 400D  ..                                                                                             ..                       * *     *             **                  
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eee..eeeee.....hhhhhhhhhhhh..ee....hhhhhhhhhhhhh...eeeeeee.....eee......hhhhhhhhh......hhhhh..eeee.......eeee......eeeeeee....
sequence :  ..ALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKA..GDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPS
seq num:  ..166       176       186       196       206       216       226       236       246          ..262       272       282       292       302       312       322  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  || |  ||  ^***        | | || |                       |  | |      |  |  |   || |    |||   ..   |  | |  |   ||||||  | | | | | |    | | | |   || |     |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  || |  ||   |          | | || |                       |  | |      |  |  |   || |    |||   ..   |  | |  |   ^**|||  | | | | | |    | | | |   || |     |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  || |  ||   |          | | || |                       |  | |      ^***  |   || |    |||   ..   ^*** |  |   || |||  | | | | | |    | | | |   || |     |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  || |  ^*****          | | || |                       |  | |            |   || |    |^****..      | |  |   || |||  | | | | | |    | | | |   || |     |       
search RasMol script viewer Motif-ligand binding stats  C_TYPE_LECTIN_1 .. |  || |   |              | | || |                       |  | |            |   || |    | |   ..      | |  |   || |||  | | | | | ^***************^*******^       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. ***** |   |              | | || |                       |  | |            |   || |    | |   ..      | |  |   || |||  | | | | |      | | | |   |  |             
search RasMol script viewer Motif-ligand binding stats  asxmotif .. |  |  |   |              | | || |                       |  | |            |   || |    | |   ..      | |  *****| |||  | | | | |      | | | |   |  |             
search RasMol script viewer Motif-ligand binding stats  asxturn .. |  |  |   |              | | || |                       |  | |            |   || |    | |   ..      ***      || |||  | | | | |      | | | |   |  |             
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****  |   |              | **** |                       **** |            |   || |    | |   ..      | |      ****|**** | | | |      | | | |   |  |             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       |   |              |   || |                          | |            |   || |    | |   ..      | |       |  ||  | | | | |      *** | |   |  |             
search RasMol script viewer Motif-ligand binding stats  nest ..       |   |              |   |***                          ***            |   |***    | |   ..      ***       |  ||  | *** ***          | |   |  |             
search RasMol script viewer Motif-ligand binding stats  niche ..       |   |              |   |                                            |   |       ***   ..                ********                  ***   ****             
search RasMol script viewer Motif-ligand binding stats  ststaple ..       *****              *****                                            *****             ..                                                                 

chain E : C-TYPE LECTIN DOMAIN FAMILY 4 MEMBER K
member of: CATH:search3.10.100.10GENE3D:searchG3DSA_1.20.1170.10/searchG3DSA_3.10.100.10PANTHER:searchPTHR22802/searchPTHR22802_SF14PFAM:searchPF00059PROSITE PATTERNS:searchPS00615, PROSITE PROFILES:searchPS50041, SMART:searchSM00034SUPERFAMILY:searchSSF56436UniProt:searchQ9UJ71
JMol viewer RasMol script viewer  CA 400E  ..                                                                                                                      * *     *             **                  
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhhh...eee..eeeee.....hhhhhhhhhhh...ee....hhhhhhhhhhhhh...eeeeeee......eee........hhhhhhh......hhhhh..eeee.......eeee......eeeeeee....
sequence :  ..LNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPS
seq num:  ..167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |  || ||  ^***        |   || |                       |  | |      |  |  |   || |    |||   |  |  |  | |  | | ||| ||  | ||| | | |        | |   || |     |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  || ||   |          |   || |                       |  | |      |  |  |   || |    |||   |  |  |  | |  | | ^** ||  | ||| | | |        | |   || |     |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  |  || ||   |          |   || |                       |  | |      ^***  |   || |    |||   |  |  ^*** |  | |  |  ||  | ||| | | |        | |   || |     |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |  || ^*****          |   || |                       |  | |            |   || |    |^*****  |     | |  | |  |  ||  | ||| | | |        | |   || |     |       
search RasMol script viewer Motif-ligand binding stats  C_TYPE_LECTIN_1 ..|  |  ||  |              |   || |                       |  | |            |   || |    | |   |  |     | |  | |  |  ||  | ||| | | ^***************^*******^       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  *****  |              |   || |                       |  | |            |   || |    | |   |  |     | |  | |  |  ||  | ||| | |          | |   |  |             
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  |  |   |              |   || |                       |  | |            |   || |    | |   |  |     ***  ***  |  ||  | ||| | |          | |   |  |             
search RasMol script viewer Motif-ligand binding stats  betaturn ..*******   |              |   || |                       **** |            |   || |    | |   |  |     | |       |  |**** |**** |          | |   ****             
search RasMol script viewer Motif-ligand binding stats  nest ..      |   |              |   |***                          ***            |   |***    | |   |  |     ***       |  ||  | *** ***          | |   |  |             
search RasMol script viewer Motif-ligand binding stats  niche ..      |   |              |   |                                            |   |       ***   ****               ********                  ***   ****             
search RasMol script viewer Motif-ligand binding stats  ststaple ..      *****              *****                                            *****                                                                                 

chain F : C-TYPE LECTIN DOMAIN FAMILY 4 MEMBER K
member of: CATH:search3.10.100.10GENE3D:searchG3DSA_1.20.1170.10/searchG3DSA_3.10.100.10PANTHER:searchPTHR22802/searchPTHR22802_SF14PFAM:searchPF00059PROSITE PATTERNS:searchPS00615, PROSITE PROFILES:searchPS50041, SMART:searchSM00034SUPERFAMILY:searchSSF56436UniProt:searchQ9UJ71
JMol viewer RasMol script viewer  CA 400F  ..                                                                                                                        * *     *             **                  
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eee..eeeee.....hhhhhhhhhhh...ee....hhhhhhhhhhhhh...eeeeeeee....eeee......hhhhhhhhh......hhhhh..eeee.......eeee......eeeeeee....
sequence :  ..SALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPS
seq num:  ..165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           |   ^***        | | || |                          | |      |  || |  |||||    |||   | | | |  | |      ||||||  | ||| |   |      | | |   || |     |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |    |          | | || |                          | |      |  || |  |||||    |||   | | | |  | |      ^**|||  | ||| |   |      | | |   || |     |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           |    |          | | || |                          | |      ^***| |  |||||    |||   | | | ^*** |      || |||  | ||| |   |      | | |   || |     |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           ^*****          | | || |                          | |      |   | |  |||||    |^***** | |    | |      || |||  | ||| |   |      | | |   || |     |       
search RasMol script viewer Motif-ligand binding stats  C_TYPE_LECTIN_1 ..                           | | || |                          | |      |   | |  |||||    | |     | |    | |      || |||  | ||| |   ^***************^*******^       
search RasMol script viewer Motif-ligand binding stats  betaturn ..                           | **** |                          | |      |   | |  ****|    | |     | |    | |      ****|**** |****          | | |   ****             
search RasMol script viewer Motif-ligand binding stats  nest ..                           |   |***                          ***      |   | |   |***    | |     ***    ***       |  ||  | ***            | | |   |  |             
search RasMol script viewer Motif-ligand binding stats  niche ..                           |   |                                      |   | |   |       ***                      ********                | ***   ****             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                           |   |                                      ***** |   |                                                        | |                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                           *****                                            *****                                                        | |                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                         ***                      

   New search    3kqg:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors