triangle PDBeMotif: 3kmu  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification cell adhesion    | release date: Wed, Nov 11, 2009
Title crystal structure of the ilk/alpha-parvin core complex (apo)
Authors J.QIN, K.FUKUDA
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPP
APHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVK
FSFQSPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHV
SKLMKICMNEDPAKRPKFDMIVPILEKMQDK
Chain B sequence:
GSHMDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQK
VLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTEGRIN-LINKED KINASE
member of: GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR23257/searchPTHR23257_SF30PFAM:searchPF07714PIRSF:searchPIRSF000654PROSITE PROFILES:searchPS50011, SUPERFAMILY:searchSSF56112UniProt:searchQ13418
sec str:  ......hhhhheeeeeeeee..eeeeeeee..eeeeeeee.....hhhhhhhhhhhhhhhh......ee...eee........eeeee.....hhhhhhhh......hhhhhhhhhhhhhhhhhhhh...............eee.....eeee.hhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhh.
sequence :  ..HSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQSPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVSKLMKICMNEDPAKRPKFDMIVPILEKMQD
seq num:  ..185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  ||| |  ||    ^***      |  |        |  || |        |  | |  |  |         | |            |    ||  |  |  |   |            || ||   |  |   || |    | | | || || |  ||  |   |  |   |  ||| ||||  |             | |  | |||  |||    ||||   ||  ||   |    |  | || ||          |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  ||| |  ||              |  |        |  |^**        |  | |  |  |         | |            |    ||  |  |  |   |            || ||   |  |   || |    | ^** || || |  ||  |   |  |   |  ||| |^**  |             | |  | |||  |||    ||||   ||  ||   |    |  | || ||          |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***|| |  ||              |  |        |  |           |  | |  |  |         | |            |    ||  |  |  |   |            || ||   |  |   || |    | |   ^***| |  ||  |   |  |   |  ||| |||   |             | |  | ||^***||    ||||   ||  ||   |    |  | || ||          |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ||| |  ||              |  |        |  |           |  | |  |  |         | |            ^*****|  |  |  |   |            || ||   |  |   || |    | |    |  | |  ||  |   |  |   |  ||| |||   |             | |  | |||   |^*****|^*****|  ||   |    |  | || ||          |  | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    ||| |  ||              |  |        |  |           |  | |  |  |         | |                  |  |  |  *****            || ||   |  |   || |    | |    |  | |  ||  |   |  |   |  ||| ||*****             | |  | |||   |      | |    |  ||   |    |  | || ||          |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..    *** |  ||              |  |        |  |           |  | |  |  |         | |                  |  |  |                   || ||   |  |   || |    | |    |  | |  ||  |   |  |   |  ||| ||                  | |  | |||   |      | |    |  ||   |    |  ***| ||          |  | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..     |  |  **              |  |        |  |           |  | |  |  |         | |                  |  |  |                   || ||   |  |   || |    | |    |  | |  ||  |   |  |   |  ||| ||                  | |  | |||   |      | |    |  ||   |    |  | || ||          |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..     |  |                  ****        |  |           **** |  |  |         | |                  |  |  |                   ****|   |  |   || |    | |    |  | ****|  |   ****   |  |****|                  | |  | |||   |      | |    |  ||   |    |  | ****|          |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                              |  |                |  |  |         | |                  |  |  |                    |  |   |  |   || |    ***    |  | |  ||  |   |  |   |  | |  |                  ***  ***||   |      ***    |  ||   |    |  | ||  |          |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                              ****                *******         ***                  *******                    ****   ****   ****           **** ********   ****   **** ****                  | |  ****|   |             ****|   |    **********          **** 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                                                          |                                                               | |      *****                 *****                             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                          |                                                               ***                                                              
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                          *                                                                                                                                

chain B : ALPHA-PARVIN
member of: CATH:search1.10.418.10GENE3D:searchG3DSA_1.10.418.10PANTHER:searchPTHR12114/searchPTHR12114_SF6PFAM:searchPF00307PIRSF:searchPIRSF039131PROSITE PROFILES:searchPS50021, SMART:searchSM00033SUPERFAMILY:searchSSF47576UniProt:searchQ9NVD7
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhh...hhhhh.....hhhhhhhhhhhhhhhhhhh.......hhhhhhh.hhhhhhhhhhhhhhhhh...
sequence :  ..AFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE
seq num:  ..249       259       269       279       289       299       309       319       329       339       349       359       369 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  |                    || |||  |  |    ||||     |  | |   |  |     |   |  ^***    || |||  | |    | |||   | |  |   |  | | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  |                    || |||  |  |    ||||     |  | |   |  |     |   |          || |||  | |    | |||   ^**  |   |  | | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ^***                    || |||  ^***    ||||     |  | |   |  |     |   |          || |||  | |    | |||        |   |  | | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                           || |||          ||||     ^*****   |  |     |   |          || |||  | |    | |||        |   |  | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                           |****|          ||||        | |   |  |     |   |          |****|  | |    ****|        |   |  | | 
search RasMol script viewer Motif-ligand binding stats  nest ..                           |  ***          ****        ***   |  |     |   |          |  ***  | |      ***        |   |  | | 
search RasMol script viewer Motif-ligand binding stats  niche ..                           |    |                            ****     |   |          |    |  ***                 |   |  *** 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                           ******                                     |   |          ******                      |   |      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                      *****                                      |   |      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                 *****      

   New search    3kmu:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors