triangle PDBeMotif: 3kb5  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification membrane protein    | release date: Tue, Oct 20, 2009
Title pry-spry domain of human trim72
Authors B.-C.JEONG, E.Y.PARK, H.K.SONG, O.-B.KWON
Method X-RAY DIFFRACTION (resolution: 1.50Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
RKMFRALMPALEELTFDPSSAHPSLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAHQQLSEGEHYWEVDVGDKPRW
ALGVIAAEAPRRGRLHAVPSQGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVP
LFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLV
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRIPARTITE MOTIF-CONTAINING PROTEIN 72
member of: PANTHER:searchPTHR24103/searchPTHR24103_SF11PFAM:searchPF00622/searchPF13765PRINTS:searchBUTYPHLNCDUFPROSITE PROFILES:searchPS50188, SMART:searchSM00589SUPERFAMILY:searchSSF49899UniProt:searchQ6ZMU5
sec str:  ..hhhhhhhh................eeee....eeee...................eee........eeeeeee......eeeeeee...........hhhh.eeeeeee...eeee.......ee.........eeeeeee....eeeeee.......eeeeee.......eeeeee............eee.
sequence :  ..RKMFRALMPALEELTFDPSSAHPSLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAHQQLSEGEHYWEVDVGDKPRWALGVIAAEAPRRGRLHAVPSQGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLV
seq num:  ..278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458          
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    |  |         |  ||  |  | ||||           | | |||  |    | |  |  |       | |     |  | ||| |   | || |||   | |  |                  **^*  |   || | | |  | || |    || | |          | | |||||| |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  |         |  ||  |  | ^**|           | | |||  |    | |  |  |       | |     |  | ||| |   | || |||   | |  |                        |   || | | |  | || |    || | |          | | |||||| |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    |  |         |  ||  |  | || |           | | |||  |    | |  ^***       | |     |  | ||| |   | || |||   | |  |                        |   ^*** | ^*** ^***    || | |          | | |||||| |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    |  |         |  ||  |  | || |           | | |||  |    | |             | |     ^*****|| |   | || |||   ^*****                        ^***** | |    | ||      || | |          | | |||||| |     
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..    |  |         |  ||  |  | ^***           | | |||  |    | |             | |        |  || |   | || |||     |  |                               | |    | ||      || | |          | | |||||| |     
search RasMol script viewer Motif-ligand binding stats  asxturn ..    |  |         |  ||  |  |  | |           | ***||  |    | |             | |        |  || |   | || |||     |  |                               | |    ***|      || | |          *** |||||| |     
search RasMol script viewer Motif-ligand binding stats  betabulge ..    |  |         |  ||  |  |  | |           | |  ||  |    | |             | |        |  || |   | || |||     |  |                               | |    |  |      ** | |              |||||| |     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..    |  |         |  ||  |  ******           | |  ||  |    | |             | |        |  || |   | || |||     |  |                               | |    |  |         | |              |||||| |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |  |         |  ||  |     | |           | |  ||  |    | |             | |        |  || |   | |****|     ****                               | |    |  |         | |              |****| |     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    |  |         |  ||  |     | |           | |  ||  |    | |             | |        |  || |   ***  | |                                        | |    |  |         | |              | || | |     
search RasMol script viewer Motif-ligand binding stats  nest ..    |  |         |  ||  |     ***           | |  ||  |    | |             | |        |  || |        ***                                        ***    |  |         | |              ****** |     
search RasMol script viewer Motif-ligand binding stats  niche ..    ****         ********                   **********    ***             ***        *******                                                          ****         ***                   ***     

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRIPARTITE MOTIF-CONTAINING PROTEIN 72
member of: PANTHER:searchPTHR24103/searchPTHR24103_SF11PFAM:searchPF00622/searchPF13765PRINTS:searchBUTYPHLNCDUFPROSITE PROFILES:searchPS50188, SMART:searchSM00589SUPERFAMILY:searchSSF49899UniProt:searchQ6ZMU5
sec str:  ..hhhhhhhh................eeee....eeee...................eee........eeeeeee......eeeeeee...........hhhh.eeeeeee...eeee.......ee.........eeeeeee....eeeeee.......eeeeee.......eeeeee............eee.
sequence :  ..RKMFRALMPALEELTFDPSSAHPSLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAHQQLSEGEHYWEVDVGDKPRWALGVIAAEAPRRGRLHAVPSQGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLV
seq num:  ..278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458          
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    |  |         |  ||  |  | ||||           | | |||  |    | |  |  |       | |     |  | ||| |   | || |||   | |  |                  **^*  |   || | | |  | || |    || | |          | | |||||| |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  |         |  ||  |  | ^**|           | | |||  |    | |  |  |       | |     |  | ||| |   | || |||   | |  |                        |   || | | |  | || |    || | |          | | |||||| |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    |  |         |  ||  |  | || |           | | |||  |    | |  ^***       | |     |  | ||| |   | || |||   | |  |                        |   ^*** | ^*** ^***    || | |          | | |||||| |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    |  |         |  ||  |  | || |           | | |||  |    | |             | |     ^*****|| |   | || |||   ^*****                        ^***** | |    | ||      || | |          | | |||||| |     
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..    |  |         |  ||  |  | ^***           | | |||  |    | |             | |        |  || |   | || |||     |  |                               | |    | ||      || | |          | | |||||| |     
search RasMol script viewer Motif-ligand binding stats  asxturn ..    |  |         |  ||  |  |  | |           | ***||  |    | |             | |        |  || |   | || |||     |  |                               | |    ***|      || | |          *** |||||| |     
search RasMol script viewer Motif-ligand binding stats  betabulge ..    |  |         |  ||  |  |  | |           | |  ||  |    | |             | |        |  || |   | || |||     |  |                               | |    |  |      ** | |              |||||| |     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..    |  |         |  ||  |  ******           | |  ||  |    | |             | |        |  || |   | || |||     |  |                               | |    |  |         | |              |||||| |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |  |         |  ||  |     | |           | |  ||  |    | |             | |        |  || |   | |****|     ****                               | |    |  |         | |              |****| |     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    |  |         |  ||  |     | |           | |  ||  |    | |             | |        |  || |   ***  | |                                        | |    |  |         | |              | || | |     
search RasMol script viewer Motif-ligand binding stats  nest ..    |  |         |  ||  |     ***           | |  ||  |    | |             | |        |  || |        ***                                        ***    |  |         | |              ****** |     
search RasMol script viewer Motif-ligand binding stats  niche ..    ****         ********                   **********    ***             ***        *******                                                          ****         ***                   ***     

   New search    3kb5:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors