triangle PDBeMotif: 3isl  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.
Classification transferase    | release date: Wed, Aug 26, 2009
Title crystal structure of ureidoglycine-glyoxylate aminotransfera from bacillus subtilis
Authors A.PERACCHI, G.ZANOTTI, I.RAMAZZINA, L.CENDRON, R.BERNI, R.COSTA, R.PERCUDANI
Method X-RAY DIFFRACTION (resolution: 2.06Å)
PDBe Citation   
Small molecules:    search PLP PLP binding statistics PLP
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MSGRRELCTPLRTIMTPGPVEVDPRVLRVMSTPVVGQFDPAFTGIMNETMEMLRELFQTKNRWAYPIDGTSRAGIEAVLA
SVIEPEDDVLIPIYGRFGYLLTEIAERYGANVHMLECEWGTVFDPEDIIREIKKVKPKIVAMVHGETSTGRIHPLKAIGE
ACRTEDALFIVDAVATIGGCEVKVDEWKIDAAIGGTQKCLSVPSGMAPITYNERVADVIAARKKVERGIATQADRAALSG
NRPITSNYFDLSQLEDYWSERRLNHHTEATTMLYALREGVRLVLEEGLETRFERHRHHEAALAAGIKAMGLRLFGDDSCK
MPVVTCVEIPGGIDGESVRDMLLAQFGIEIASSFGPLAGKIWRIGTMGYSCRKENVLFVLAGLEAVLLRHNAGIEAGKAL
QAALDVYENAGRQAAV
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PURINE CATABOLISM PROTEIN PUCG
member of: CATH:search3.40.640.10/search3.90.1150.10GENE3D:searchG3DSA_3.40.640.10/searchG3DSA_3.90.1150.10PANTHER:searchPTHR21152/searchPTHR21152_SF7PFAM:searchPF00266PIRSF:searchPIRSF000524PROSITE PATTERNS:searchPS00595, SUPERFAMILY:searchSSF53383UniProt:searchO32148
JMol viewer RasMol script viewer  PLP 419B  ..                                                                                                                                                                                                                          ..PLP ..                          *                                                                                                                                              
JMol viewer RasMol script viewer  PLP 419A  ..                                                                 ***                        *                                             * * *                        * *                      **                        ..PLP ..                          |                                                                                                                                              
sec str:  ..........ee........hhhhhhhh........hhhhhhhhhhhhhhhhhhh.....eeeeee.hhhhhhhhhhhhhh....eeeeee.hhhhhhhhhhhhhh..eeeeee.......hhhhhhhhhhhhh..eeeee.ee....ee..hhhhhhhhhhh..eeeee..................eee............eeeeeehhhhhhhhhh.... ...........hhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhh...eeeee.....hhhhhhhhhhhhhhee...........eeeee.hhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhh
sequence :  ..RELCTPLRTIMTPGPVEVDPRVLRVMSTPVVGQFDPAFTGIMNETMEMLRELFQTKNRWAYPIDGTSRAGIEAVLASVIEPEDDVLIPIYGRFGYLLTEIAERYGANVHMLECEWGTVFDPEDIIREIKKVKPKIVAMVHGETSTGRIHPLKAIGEACRTEDALFIVDAVATIGGCEVKVDEWKIDAAIGGTQKCLSVPSGMAPITYNERVADVIAAR... ..NRPITSNYFDLSQLEDYWSERRLNHHTEATTMLYALREGVRLVLEEGLETRFERHRHHEAALAAGIKAMGLRLFGDDSCKMPVVTCVEIPGGIDGESVRDMLLAQFGIEIASSFGPLAGKIWRIGTMGYSCRKENVLFVLAGLEAVLLRHNAGIEAGKALQAALDVYEN
seq num:  ..7         17        27        37        47        57        67        77        87        97        107       117       127       137       147       157       167       177       187       197       207       217     ... ..243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|        | | |    | |   |  |   |  | |||   ^***      | | | |     || | |     || ||  |         |        | |||       |  |  | |                      | |             | |    | | |||||      | |     || | | ||  |  || ||  |      ..PS00001..   | ||  | |  |   | ||| |                        |  |            || |||    | | ||  ||  | || || || ||     |||   |  |  || |     || |||               | |||| |  |           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|        | | |    | |   |  |   |  | |||             | | | |     |^** |     || ||  |         |        | |||       |  |  | |                      ^**             | |    | | |||||      | |     |^** | ||  |  || ||  |      ..PS00005..   | ||  | |  |   ^**|| |                        |  |            || |||    | ^**|  ||  | || || |^**|     |||   |  |  || |     || ^**               | |||| |  |           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|        | | |    | |   |  |   |  | |||             | | | |     |    |     |^***  |         |        | |||       |  ^*** |                      | |             | |    | | |||||      | |     |  | | ||  |  |^***  |      ..PS00006..   | ||  | ^***   | ||| |                        ^***            || |||    | |  |  |^*** || || |^***     |||   |  |  || |     || ||                | |||| |  |           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|        | | |    | |   |  |   |  | |||             | | | |     ^*****     |  ||  |         |        | |||       |  |  | |                      | |             | |    | | |||||      | |     ^***** ||  |  |  |   |      ..PS00008..   | ||  | |  |   | ||| |                                        || |||    | |  |  |     |^*****         |^*****  |  || |     || ||                | |||^*****           
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..*        | | |    | |   |  |   |  | |||             | | | |                |  ||  |         |        | |||       |  |  | |                      | |             | |    | | |||||      | |        | | ||  |  |  |   |      ..PS00009..   | ||  | |  |   | ||| |                                        || |||    | |  |  |     |  || |         | |      |  || |     || ||                | |||  |  |           
search RasMol script viewer Motif-ligand binding stats  AA_TRANSFER_CLASS_5 ..         | | |    | |   |  |   |  | |||             | | | |                |  ||  |         |        | |||       |  |  | |                      | |             | |    | | |||||      | *********^***********  |   |      ..PS00595..   | ||  | |  |   | ||| |                                        || |||    | |  |  |     |  || |         | |      |  || |     || ||                | |||  |  |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         | | |    | |   |  |   |  *****             | | | |                |  ||  |         |        | |||       |  |  | |                      | |             | |    | | |||||      | |        | | ||  |     |   |      ..alphabetamotif..   | ||  | |  |   | ||| |                                        || |||    | |  |  |     |  || |         | |      |  || |     || ||                | |||  |  |           
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         | | |    | |   |  |   |  *****             | | | |                |  ||  |         |        | |||       |  |  | |                      | |             | |    | | |||||      | |        | | ||  |     *****      ..asxmotif..   | ||  | |  |   | ||| |                                        || |||    | |  |  |     |  || |         | |      |  || |     || ||                | |||  |  |           
search RasMol script viewer Motif-ligand binding stats  asxturn ..         | | |    ***   |  |   |  ***|              | | | |                |  ||  |         |        | |||       |  |  ***                      | |             | |    *** |||||      | |        | | ||  |                ..asxturn..   | ||  ***  |   | ||| |                                        || |||    ***  |  |     |  |***         | |      |  || |     || ||                | |||  |  |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..         | | |          |  |   |  ****              | | | |                |  |****         |        ****|       ****                           | |             | |    | | ****|      | |        | | ||  |                ..betaturn..   | ||  |    |   ****| |                                        |****|         |  |     ****            | |      ****| |     *****                ****|  ****           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | | |          |  |   |  |                 | | | |                |  ||  |         |          | |       |  |                           | |             | |    | |  || |      | |        | | ||  |                ..gammaturn..   | ||  |    |   | | ***                                        |  | |         |  |     |  |            | |      |  || |                            | |                 
search RasMol script viewer Motif-ligand binding stats  nest ..         | | |          |  |   |  |                 *** | |                |  ||  |         |          ***       |  |                           ***             ***    | |  |***      ***        | ***|  |                ..nest..   | ||  |    |   | ***                                          |  ***         |  |     |  |            ***      |  |***                            ***                 
search RasMol script viewer Motif-ligand binding stats  niche ..         *** |          ****   ****                   *****                ********         |                    ****                                                  | ****                    |    ****                ..niche..   *******    |   |                                              |    |         ****     ****                     ****                                                   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..           | |                                        | |                                   |                                                                          |                         |                        ..schellmannloop..              |   |                                              ******                                                                                                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..           | |                                        | |                                   |                                                                          |                         |                        ..ststaple..              *****                                                                                                                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..           ***                                        ***                                   |                                                                          |                         |                        ..stturn..                                                                                                                                                                         
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                            *                                                                          *                         *                        ..REP00000..                                                                                                                                                                         

chain B : PURINE CATABOLISM PROTEIN PUCG
member of: CATH:search3.40.640.10/search3.90.1150.10GENE3D:searchG3DSA_3.40.640.10/searchG3DSA_3.90.1150.10PANTHER:searchPTHR21152/searchPTHR21152_SF7PFAM:searchPF00266PIRSF:searchPIRSF000524PROSITE PATTERNS:searchPS00595, SUPERFAMILY:searchSSF53383UniProt:searchO32148
JMol viewer RasMol script viewer  PLP 419B  ..                                                                 ***                        *                                             * * *                        * *                      **                        ..PLP ..                                                                                                                                                                         
JMol viewer RasMol script viewer  PLP 419A  ..                                                                 |||                        |                                             | | |                        | |                      ||                        ..PLP ..                         **                                                                                                                                              
sec str:  ..........ee........hhhhhhhh........hhhhhhhhhhhhhhhhhhh.....eeeee..hhhhhhhhhhhhhh....eeeeee.hhhhhhhhhhhhhh..eeeeee.......hhhhhhhhhhhhh..eeeee.ee....ee..hhhhhhhhhhh..eeeee..................eee.............eeeeehhhhhhhhhh.... ...........hhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhh...eeeee.....hhhhhhhhhhhhhhee...........eeeee.hhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhh
sequence :  ..RELCTPLRTIMTPGPVEVDPRVLRVMSTPVVGQFDPAFTGIMNETMEMLRELFQTKNRWAYPIDGTSRAGIEAVLASVIEPEDDVLIPIYGRFGYLLTEIAERYGANVHMLECEWGTVFDPEDIIREIKKVKPKIVAMVHGETSTGRIHPLKAIGEACRTEDALFIVDAVATIGGCEVKVDEWKIDAAIGGTQKCLSVPSGMAPITYNERVADVIAAR... ..NRPITSNYFDLSQLEDYWSERRLNHHTEATTMLYALREGVRLVLEEGLETRFERHRHHEAALAAGIKAMGLRLFGDDSCKMPVVTCVEIPGGIDGESVRDMLLAQFGIEIASSFGPLAGKIWRIGTMGYSCRKENVLFVLAGLEAVLLRHNAGIEAGKALQAALDVYEN
seq num:  ..7         17        27        37        47        57        67        77        87        97        107       117       127       137       147       157       167       177       187       197       207       217     ... ..243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|        | | |    | |   |  |   |  | |||   ^***      | | | |     || | |     || ||  |         |        | |||       |  |  | |                      | |             | |    | | |||||      | |     || | | ||  |  || ||  |      ..PS00001..   | ||  | |  |   | | | |                        |  |             | |||    ||| ||  ||  | || || || ||     |||   |  | |||||     || |||                 | ||   |||          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|        | | |    | |   |  |   |  | |||             | | | |     |^** |     || ||  |         |        | |||       |  |  | |                      ^**             | |    | | |||||      | |     |^** | ||  |  || ||  |      ..PS00005..   | ||  | |  |   ^** | |                        |  |             | |||    ||^**|  ||  | || || |^**|     |||   |  | |||||     || ^**                 | ||   |||          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|        | | |    | |   |  |   |  | |||             | | | |     |    |     |^***  |         |        | |||       |  ^*** |                      | |             | |    | | |||||      | |     |  | | ||  |  |^***  |      ..PS00006..   | ||  | ^***   | | | |                        ^***             | |||    ||| ||  |^*** || || |^***     |||   |  | |||||     || ||                  | ||   |||          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|        | | |    | |   |  |   |  | |||             | | | |     ^*****     |  ||  |         |        | |||       |  |  | |                      | |             | |    | | |||||      | |     ^***** ||  |  |  |   |      ..PS00008..   | ||  | |  |   | | | |                                         | |||    ||| ||  |     |^*****         |^*****  | |||||     || ||                  | |^*****|          
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..*        | | |    | |   |  |   |  | |||             | | | |                |  ||  |         |        | |||       |  |  | |                      | |             | |    | | |||||      | |        | | ||  |  |  |   |      ..PS00009..   | ||  | |  |   | | | |                                         | |||    ||| ||  |     |  || |         | |      | |||||     || ||                  | |    | |          
search RasMol script viewer Motif-ligand binding stats  AA_TRANSFER_CLASS_5 ..         | | |    | |   |  |   |  | |||             | | | |                |  ||  |         |        | |||       |  |  | |                      | |             | |    | | |||||      | *********^***********  |   |      ..PS00595..   | ||  | |  |   | | | |                                         | |||    ||| ||  |     |  || |         | |      | |||||     || ||                  | |    | |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         | | |    | |   |  |   |  *****             | | | |                |  ||  |         |        | |||       |  |  | |                      | |             | |    | | |||||      | |        | | ||  |     |   |      ..alphabetamotif..   | ||  | |  |   | | | |                                         | |||    ||| ||  |     |  || |         | |      | |||||     || ||                  | |    | |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         | | |    | |   |  |   |  *****             | | | |                |  ||  |         |        | |||       |  |  | |                      | |             | |    | | |||||      | |        | | ||  |     *****      ..asxmotif..   | ||  | |  |   | | | |                                         | |||    ||| ||  |     |  || |         | |      | |||||     || ||                  | |    | |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..         | | |    ***   |  |   |  ***|              | | | |                |  ||  |         |        | |||       |  |  ***                      | |             | |    *** |||||      | |        | | ||  |                ..asxturn..   | ||  ***  |   | | | |                                         | |||    *** ||  |     |  |***         | |      | |||||     || ||                  | |    | |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..         | | |          |  |   |  ****              | | | |                |  ||  |         |        ****|       ****                           | |             | |    | | ****|      | |        | | ||  |                ..betaturn..   | ||  |    |   | | | |                                         ****|     |  ||  |     |  |            | |      | ****|     *****                  | |    | |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | | |          |  |   |  |                 | | | |                |  ||  |         |          | |                                      | |             | |    | |  || |      | |        | | ||  |                ..gammaturn..   | ||  |    |   | | ***                                           | |     |  ||  |     |  |            | |      |  || |                            | |    | |          
search RasMol script viewer Motif-ligand binding stats  nest ..         | | |          |  |   |  |                 *** | |                |  ||  |         |          ***                                      ***             ***    | |  |***      ***        | ***|  |                ..nest..   | ||  |    |   | ***                                             ***     |  ||  |     |  |            ***      |  |***                            ***    ***          
search RasMol script viewer Motif-ligand binding stats  niche ..         *** |          ****   ****                   *****                ********         |                                                   | |                    | ****                    |    ****                ..niche..   *******    |   |                                                         ********     ****                     ****                                                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..           | |                                        | |                                   |                                                   | |                    |                         |                        ..ststaple..              *****                                                                                                                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..           ***                                        ***                                   |                                                   ***                    |                         |                        ..stturn..                                                                                                                                                                         
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                            *                                                                          *                         *                        ..REP00000..                                                                                                                                                                         

   New search    3isl:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors