triangle PDBeMotif: 3i8e  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification protein binding    | release date: Thu, Jul 9, 2009
Title crystal structure of ddb1 in complex with the h-box motif of
Authors E.I.ROBERT, M.STRUBIN, N.ZHENG, P.C.V.BREUGEL, T.LI
Method X-RAY DIFFRACTION (resolution: 3.40Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GSHMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLL
FILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNI
RLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESI
TYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYL
DNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIH
EHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVR
LVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCA
IGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTV
LRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPL
YESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQH
TFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFN
GKLLASINSTVRLYEWTTEKDVRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAV
EILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMI
GLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDG
SGMKREATADDLIKVVEELTRIH
Chains C,D sequence:
QALPALRERELGS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DNA DAMAGE-BINDING PROTEIN 1
member of: GENE3D:searchG3DSA_2.130.10.10PANTHER:searchPTHR10644/searchPTHR10644_SF3PFAM:searchPF03178/searchPF10433SUPERFAMILY:searchSSF50978UniProt:searchQ16531
sec str:  .....eeeeeee......eeeee........eeeee....eeeeee....eeeeeee.....eeeeeee........eeeeee...eeeeeeeee....eeeeeeeeee.............eeee.....eeeee....eeeeee..........eeee.....eeeeee.......eeeeeeee..eeeeeeee...............ee......eeee.......eeee....eeee....eeee.hhhhhh.....eee......eeee.....eeeeeeeeee.......eeeeeeeeeeee...eeeeee....eeeeee.....eeeee..........eeeeee........eeeee........eeeeee.hhhh.eeeeeee.ee.............eeeee..........eeeee....eeeeee....ee............eee.......eeeeee...eeeee........ee..........eee....eeee....eeeeee....eee.........eeeee............eeeeee....eeeeee.........ee......eeeeeeee....eeeeeee....eeee.............ee.......eeee........eeee....eee.........eeee.....eeee.........eeee.....ee........eee..ee...eeeeeeee....eeeeeeeeeee....................eee........... ....eeeeeeeeeee.....eeeeee....eeeeeee...........eeeeeee............eeeeee....eeeee..........eee....eeee....eeeeee.....ee....................eee.......eeeeee....eeeeeee......eeeeee.....eeeee...eeeeeee............eeeeeee.....eeeeee......... ....eeeeeeee....eeeeee.hhhhhhhhhhhhhhhhhhh......hhhhhh.eee..eee....eeehhhhhhhhhhhhhhhhhhh..........hhhhhh.......
sequence :  ..MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSS... ..GEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKDVRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQ... ..PTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVAN..REATADDLIKVVEELTRIH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761          ... ..783       793       803       813       823       833       843       853       863       873       883       893       903       913       923       933       943       953       963       973       983       993       1003         ... ..1023      1033      1043      1053      1063      1073      1083      1093      1103     ..1122      1132     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |        | | ||    | |  |        ||| |         |       |          |  |        | | |                     | || |    | |     | ||||     |  |         | | |     | |        |  |          |  |        | || |                                                               | ^***      | |          | |   | ||         |  || |  |  |   |    |              | |  ||   | | |      ||||| ||    |   |  || |               |  |        | |          | |        | |     |  ||  |                   | |              | |  ^***   ^***     | |      |  |    |  |            |  |             | | |     | |                  |  |          | |         | | | || || | |  |  | | | |      | |                               |  |    ^***    |  | | |      | || |       | | |  ||| |     |    |    |  |     |||||   ..PS00001.. |             | | ||    |  |      | | | | | |                               ||||    |   || |         ^***|     ||||                 |  |                   | |      | |    |  |  |  |  |   |||          | |||  |        | |  ||    | |  ..PS00001..        |  | | |   || |       |  || |  |   | |  ||  |  | |    |  |       |  |      |  |  ..   |  |            
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  |        | | ||    | |  |        ||| |         |       |          |  |        | | |                     | || |    | |     | ||||     |  |         | | |     | |        |  |          |  |        | || |                                                               | ||||      | |          | |   | ||         |  || |  |  |   |    |              | |  ||   | | |      ||||| ||    |   |  || |               |  |        | |          | |        | |     |  ||  |                   | |              | |         | |      | |      |  |    |  |            |  |             | | |     | |                  |  |          | |         | | | |**^* | |  |  | | | |      | |                               |  |            |  | | |      | || |       | | |  ||| |     |    |    |  |     |||||   ..PS00004.. |             | | ||    |  |      | | | | | |                               ||||    |   || |           | |     ||||                 |  |                   | |      | |    |  |  |  |  |   |||          | |||  |        | |  ||    | |  ..PS00004..        |  | | |   || |       |  || |  |   | |  ||  |  | |    |  |       |  |      |  |  ..   |  |            
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |        | | ||    | |  |        ||| |         |       |          |  |        ^** |                     | || |    | |     | ||||     |  |         | | |     | |        |  |          |  |        ^**| |                                                               | ||||      | |          | |   ^**|         |  || |  |  |   |    |              | |  ||   | | |      ||||| ||    |   |  |^**               |  |        | |          | |        | |     |  ||  |                   ^**              | |         | |      | |      |  |    |  |            |  |             | ^**     | |                  |  |          | |         | | ^**     | |  |  ^** | |      ^**                               |  |            |  | | |      | |^**       | | |  ^** |     |    |    |  |     |^**|   ..PS00005.. |             | | ||    |  |      ^** | | | |                               ||||    |   || |           ^**     ^**|                 |  |                   | |      | |    |  |  |  |  |   |||          | |||  |        | |  ||    | |  ..PS00005..        |  | | |   || |       |  || |  |   | |  ||  |  ^**    |  |       |  |      |  |  ..   |  |            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |        | | ||    | ^***        |^***         |       |          |  |          | |                     | || |    | |     | ||||     |  |         | | |     | |        |  |          |  |        ^*** |                                                               | ||||      | |          | |   ^***         ^***| ^***  |   |    |              | |  ||   | | |      ||||| ||    |   |  |                  |  |        | |          | |        | |     |  ||  |                                    | |         | |      | |      |  |    ^***            |  |             | |       | |                  ^***          | |         | |         | |  |      | |                                        |  |            ^*** | |      | |          | | |   ^***     |    |    |  |     | | |   ..PS00006..**             | | ||    |  |        | | | | |                               ^***    |   ^***                   ^***                 ^***                   | |      | |    ^***  |  |  |   |||          ^***|  |        | |  ||    | |  ..PS00006..        |  | | |   ^***       |  || |  |   | |  ||  |  | |    |  |       ^***      |  |  ..   ^***            
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |        | | ||    |             | |           ********^          |  |          | |                     | || |    | |     | ||||     |  |         | | |     | |        |  |          |  |           | |                                                               | ||||      | |          | |                   ||    |  |   |    |              | |  ||   | | |      ||||| ||    |   |  |                  |  |        | |          | |        | |     |  ||  |                                    | |         | |      | |      |  |                    |  |             | |       | |                                | |         | |         | |  |      | |                                        |  |                 | |      | |          | | |    |       |    |    |  |     | | |   ..PS00007..               | | ||    |  |        ********^                                ||     |    |                      | |                                        | |      | |          |  |  |   |||          | |||  |        | |  ||    | |  ..PS00007..        |  | | |    |         |  || |  |   | |  ||  |  | |    |  |                 |  |  ..                   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..***        | | |^*****             | |                              |  |          | |                     | || |    | |     | ||||     |  |         | | |     | |        |  |          |  |           | |                                                               | ||||      | |          | |                   ||    |  |   ^*****              | |  ||   | | |      ||||| |^*****   |  |                  |  |        | |          | |        | |     |  ||  |                                    | |         | |      | |      |  |                    |  |             | |       | |                                | |         | |         ^*****      | |                                        |  |                 | |      | |          | | ^*****       ^*****    |  |     | | |   ..PS00008..               | | ||    |  |          | | |                                  ||     ^*****                      | |                                        | |      | |          |  |  ^*****|          | |||  |        | |  ||    | |  ..PS00008..        ^***** ^*****         |  || |  |   | |  ||  |  | |    |  |                 |  |  ..                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | | ||                  | |                              |  |          | |                     | || |    | |     | ||||     |  |         | | |     | |        |  |          |  |           | |                                                               | ||||      | |          | |                   ||    |  |                       | |  ||   | | |      ||||| |         |  |                  |  |        | |          | |        | |     |  ||  |                                    | |         | |      | |      |  |                    |  |             | |       | |                                | |         | |         | |         | |                                        |  |                 | |      | |          | |                        |  |     | | |   ..alphabetamotif..               | | ||    |  |          | | |                                  ||                                 | |                                        | |      | |          |  |      | |          | |||  |        | |  ||    | |  ..alphabetamotif..           | |                ***** |  |   | |  ||  |  | |    |  |                 |  |  ..                   
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | | ||                  | |                              |  |          | |                     | || |    | |     | ||||     |  |         | | |     | |        |  |          |  |           | |                                                               | ||||      | |          | |                   ||    |  |                       | |  ||   *** |      ||||| |         |  |                  |  |        ***          | |        | |     |  ||  |                                    | |         ***      | |      |  |                    |  |             | |       | |                                | |         | |         | |         | |                                        |  |                 | |      | |          | |                        |  |     | | |   ..asxturn..               | | ||    |  |          | ***                                  ||                                 | |                                        | |      | |          |  |      | |          | |||  |        | |  ||    | |  ..asxturn..           | |                |  |  |  |   | |  ||  |  | |    |  |                 |  |  ..                   
search RasMol script viewer Motif-ligand binding stats  betabulge ..           | | **                  | |                              |  |          | |                     | || |    | |     | ||||     |  |         | | |     | |        |  |          |  |           | |                                                               | ||||      | |          | |                   **    |  |                       | |  **     | |      ||||| |         |  |                  |  |                     | |        | |     |  ||  |                                    | |                  | |      |  |                    |  |             | |       | |                                | |         | |         | |         | |                                        |  |                 | |      | |          | |                        |  |     | | |   ..betabulge..               | | **    |  |          | | |                                  **                                 | |                                        | |      | |          |  |      | |          | |||  |        | |  **    | |  ..betabulge..           | |                |  |  |  |   | |  ||  |  | |    |  |                 |  |  ..                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |                     | |                              |  |          | |                     | || |    | |     ****||     |  |         | | |     | |        |  |          ****           | |                                                               ****||      | |          | |                         |  |                       | |         | |      ||||| |         |  |                  |  |                     | |        | |     ****|  |                                    | |                  | |      |  |                    |  |             | |       | |                                | |         | |         | |         | |                                        |  |                 | |      | |          | |                        |  |     | | |   ..betaturn..               | |       |  |          | | |                                                                     | |                                        | |      | |          |  |      | |          ****|  |        | |        | |  ..betaturn..           | |                ****  |  |   | |  ||  |  | |    |  |                 |  |  ..                   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           | |                     | |                              |  |          | |                     | || |    | |       ||||     |  |         | | |     | |        |  |                         | |                                                                 ||||      | |          | |                         |  |                       | |         ***      ||||| |         |  |                  |  |                     ***        | |     |  ||  |                                    ***                  ***      |  |                    |  |             | |       | |                                | |         | |         | |         | |                                        |  |                 | |      | |          | |                        |  |     | | |   ..gammaturn..               | |       |  |          | | |                                                                     | |                                        | |      | |          |  |      | |          | | |  |        | |        | |  ..gammaturn..           | |                      |  |   | |  ||  |  | |    |  |                 |  |  ..                   
search RasMol script viewer Motif-ligand binding stats  nest ..           | |                     | |                              |  |          ***                     | || |    | |       ****     |  |         *****     | |        |  |                         ***                                                                 ****      ***          ***                         |  |                       | |                  ***** |         |  |                  |  |                                | |     |  ||  |                                                                  |  |                    |  |             ***       ***                                ***         ***         | |         | |                                        |  |                 | |      ***          ***                        |  |     | | |   ..nest..               ***       |  |          | | |                                                                     ***                                        ***      | |          |  |      ***          *** |  |        ***        | |  ..nest..           ***                      |  |   ***  ||  |  | |    |  |                 |  |  ..                   
search RasMol script viewer Motif-ligand binding stats  niche ..           ***                     ***                              ****                                  ******    ***                ****                   ***        ****                                                                                                                                                ****                       ***                      ***         ****                  ****                                ***     ********                                                                  ****                    ****                                                                                  ***         ***                                        ****                 ***                                              ****     *** |   ..niche..               | |       ****          *****                                                                                                                         ***          ****                       ****                   | |  ..niche..                                    ****        |****  | |    ****                 ****  ..                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               | |   ..ststaple..               | |                                                                                                                                                                                                                  | |  ..ststaple..                                                *****  | |                               ..                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               ***   ..stturn..               ***                                                                                                                                                                                                                  ***  ..stturn..                                                       ***                               ..                   

chain C : WD REPEAT-CONTAINING PROTEIN 42A
member of: PANTHER:searchPTHR15574/searchPTHR15574_SF30UniProt:searchQ5TAQ9
sec str:  ...hhhhhh......
sequence :  ..QALPALRERELGS
seq num:  ..153          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  *****      
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****       

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : DNA DAMAGE-BINDING PROTEIN 1
member of: GENE3D:searchG3DSA_2.130.10.10PANTHER:searchPTHR10644/searchPTHR10644_SF3PFAM:searchPF03178/searchPF10433SUPERFAMILY:searchSSF50978UniProt:searchQ16531
sec str:  .....eeeeeee.........ee........eeeee...eeeeeee....eeeeeeee....eeeeeee........eeeeee...eeeeeeeeee..eeeeeeeeeee.............eeee......eeee....eeeee...........eeee.....eeeeee.......eeeeee......eeeeee...............ee......eeee.......eeee....eeee....eeee.hhhhhh..eeeeee......eeeeee...eeeeeeee............eeeeeeeee...eeeeee....eeeeee....eeeeee..........eeeeeee.....eeeeeee........eeeeee.hhhh.eeeeeee...eeeeeee.......eee............eee..................................ee...ee.ee....ee.............................ee......ee..eeee..ee.....ee....eeeee.............eeeee....eeeee......eeeeee......eeeeeeee....eeeeeee...eeeeee...........eeee......eeee........eeee....eee.........ee.......eeee.........eeeee..eeeeeee.....eee..ee...eeeeeeee....eeeeeeeeeee....................eee........... ....eeeeeeeeeee.....eeeeee....eee...eee........eeeeeeee...........eeeeeee....eeeeeeee....eeeeee....eeeee...eeeeee.....eeeeeee...............ee........eeeee......eeeeee......eeeeee....eeeeee...eeeeee...............eee.......eeeeee......... ....eeeeeeee....eeeeee.hhhhhhhhhhhhhhhhhhh......hhhhhh.eee..eee.....eehhhhhhhhhhhhhhhhhh...........hhhhhhhhhh...
sequence :  ..MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSS... ..GEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKDVRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQ... ..PTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVAN..REATADDLIKVVEELTRIH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761          ... ..783       793       803       813       823       833       843       853       863       873       883       893       903       913       923       933       943       953       963       973       983       993       1003         ... ..1023      1033      1043      1053      1063      1073      1083      1093      1103     ..1122      1132     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |        | |  |    | |  |        ||| |         |       |   ||     |  |        | |||        ||||            | |    | |     | ||||     |  |         | | |     | |        |  |                      | ||||                               || |    ||||                    | ^***      | |                | ||         |  |  |  |  |   |    |      | |     | |  ||   | |          |||| |    |  || ||| |               |  |           | |       |  |       | |     | |                        | |              | |  ^***   ^***                      |  |            |  |             | | |     | |                  |  |          | |         | | | || || | |  |  | | | |      | |               | |                     ^***    |  |          | || |       | | |  ||| |    |||   |    |  |     ||||    ..PS00001.. |          | || | ||    |  |      | ||| | | |                               |  |    |   || |         ^***|     ||||                 |  |                                   |  |  |  |  | | |||          | |||  |        | |  ||         ..PS00001..        |  | | |   || |                    | |  ||  |  | |    |  | |  || || ||     || |  ..   |  |            
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  |        | |  |    | |  |        ||| |         |       |   ||     |  |        | |||        ||||            | |    | |     | ||||     |  |         | | |     | |        |  |                      | ||||                               || |    ||||                    | ||||      | |                | ||         |  |  |  |  |   |    |      | |     | |  ||   | |          |||| |    |  || ||| |               |  |           | |       |  |       | |     | |                        | |              | |          | |                      |  |            |  |             | | |     | |                  |  |          | |         | | | |**^* | |  |  | | | |      | |               | |                             |  |          | || |       | | |  ||| |    |||   |    |  |     ||||    ..PS00004.. |          | || | ||    |  |      | ||| | | |                               |  |    |   || |           | |     ||||                 |  |                                   |  |  |  |  | | |||          | |||  |        | |  ||         ..PS00004..        |  | | |   || |                    | |  ||  |  | |    |  | |  || || ||     || |  ..   |  |            
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |        | |  |    | |  |        ||| |         |       |   ||     |  |        ^**||        ||||            | |    | |     | ||||     |  |         | | |     | |        |  |                      ^**|||                               || |    ||||                    | ||||      | |                ^**|         |  |  |  |  |   |    |      | |     | |  ||   | |          |||| |    |  || ||^**               |  |           | |       |  |       | |     | |                        ^**              | |          | |                      |  |            |  |             | ^**     | |                  |  |          | |         | | ^**     | |  |  ^** | |      ^**               | |                             |  |          | |^**       | | |  ^** |    |||   |    |  |     |^**    ..PS00005.. |          | || | ||    |  |      ^**|| | | |                               |  |    |   || |           ^**     ^**|                 |  |                                   |  |  |  |  | | |||          | |||  |        | |  ||         ..PS00005..        |  | | |   || |                    | |  ||  |  ^**    |  | |  || || ||     || |  ..   |  |            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |        | |  |    | ^***        |^***         |       |   ||     |  |        | |||        ||||            | |    | |     | ||||     |  |         | | |     | |        |  |                      ^***||                               || |    ||||                    | ||||      | |                ^***         ^***  ^***  |   |    |      | |     | |  ||   | |          |||| |    |  || ||                  |  |           | |       |  |       | |     | |                                         | |          | |                      ^***            |  |             | |       | |                  ^***          | |         | |         | |  |      | |                        | |                             ^***          | |          | | |   ^***    |||   |    |  |     | |     ..PS00006..**          | || | ||    |  |        ||| | | |                               ^***    |   ^***                   ^***                 ^***                                   ^***  |  |  | | |||          ^***|  |        | |  ||         ..PS00006..        |  | | |   ^***                    | |  ||  |         |  | |  || ^***|     || |  ..   ^***            
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |        | |  |    |             | |           ********^   ||     |  |        | |||        ||||            | |    | |     | ||||     |  |         | | |     | |        |  |                      |  |||                               || |    ||||                    | ||||      | |                                      |  |   |    |      | |     | |  ||   | |          |||| |    |  || ||                  |  |           | |       |  |       | |     | |                                         | |          | |                                      |  |             | |       | |                                | |         | |         | |  |      | |                        | |                                           | |          | | |    |      |||   |    |  |     | |     ..PS00007..            | || | ||    |  |        ********^                                       |    |                      | |                                                              |  |  | | |||          | | |  |        | |  ||         ..PS00007..        |  | | |    |                      | |  ||  |         |  | |  || ||  |     || |  ..                   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..***        | |  ^*****             | |                       ||     |  |        | |||        ||||            | |    | |     | ||||     |  |         | | |     | |        |  |                      |  |||                               || |    ||||                    | ||||      | |                                      |  |   ^*****      | |     | |  ||   | |          |||| ^*****  || ||                  |  |           | |       |  |       | |     | |                                         | |          | |                                      |  |             | |       | |                                | |         | |         ^*****      | |                        | |                                           | |          | | ^*****      |^*****    |  |     | |     ..PS00008..            | || | ||    |  |         || | |                                         ^*****                      | |                                                              |  |  ^*****|          | | |  |        | |  ||         ..PS00008..        ^***** ^*****                      | |  ||  |         |  | |  || ||  |     || |  ..                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |                     | |                       ||     |  |        | |||        ||||            | |    | |     | ||||     |  |         | | |     | |        |  |                      |  |||                               || |    ||||                    | ||||      | |                                      |  |               | |     | |  ||   | |          ||||         || ||                  |  |           | |       |  |       | |     | |                                         | |          | |                                      |  |             | |       | |                                | |         | |         | |         | |                        | |                                           | |          | |             | |        |  |     | |     ..alphabetamotif..            | || | ||    |  |         || | |                                                                     | |                                                              |  |    | |||          | | |  |        | |  ||         ..alphabetamotif..           | |                             | |  ||  |         |  | ***** ||  |     || |  ..                   
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | |                     | |                       ||     |  |        | |||        ||||            | |    | |     | ||||     |  |         | | |     | |        |  |                      |  |||                               || |    ||||                    | ||||      | |                                      |  |               | |     | |  ||   ***          ||||         || ||                  |  |           | |       |  |       | |     | |                                         | |          | |                                      |  |             | |       | |                                | |         | |         | |         | |                        | |                                           | |          | |             | |        |  |     | |     ..asxturn..            ***| | ||    |  |         || ***                                                                     | |                                                              |  |    | |||          | | |  |        | |  ||         ..asxturn..           | |                             | |  ||  |         |  | |  |  ||  |     || |  ..                   
search RasMol script viewer Motif-ligand binding stats  betabulge ..           | |                     | |                       **     |  |        | |||        ||||            | |    | |     | ||||     |  |         | | |     | |        |  |                      |  |||                               || |    ||||                    | ||||      | |                                      |  |               | |     | |  **                ||||         || ||                  |  |           | |       |  |       | |     | |                                         | |          | |                                      |  |             | |       | |                                | |         | |         | |         | |                        | |                                           | |          | |             | |        |  |     | |     ..betabulge..               | | **    |  |         || | |                                                                     | |                                                              |  |    | |||          | | |  |        | |  **         ..betabulge..           | |                             | |  ||  |         |  | |  |  ||  |     || |  ..                   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..           | |                     | |                              |  |        *****        ||||            | |    | |     | ||||     |  |         | | |     | |        |  |                      |  |||                               || |    ||||                    | ||||      | |                                      |  |               | |     | |                    ||||         || ||                  |  |           | |       |  |       | |     | |                                         | |          | |                                      |  |             | |       | |                                | |         | |         | |         | |                        | |                                           | |          | |             | |        |  |     | |     ..betabulgeloop..               | |       |  |         || | |                                                                     | |                                                              |  |    *****          | | |  |        | |             ..betabulgeloop..           | |                             | |  ||  |         |  | |  |  ||  |     || |  ..                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..           | |                     | |                              |  |        ****|        ||||            | |    | |     ****||     ****         | | |     | |        |  |                      |  |||                               || |    ||||                    ****||      | |                                      |  |               | |     | |                    ||||         ****|                  |  |           | |       |  |       | |     | |                                         | |          | |                                      |  |             | |       | |                                | |         | |         | |         | |                        | |                                           | |          | |             | |        |  |     | |     ..betaturn..               | |       |  |         **** |                                                                     | |                                                              |  |    ****|          | | |  |        | |             ..betaturn..           | |                             | |  |****         |  | *******|  |     ****  ..                   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           | |                     | |                              |  |          | |        ***|            | |    | |       ||||                  | | |     | |        |  |                      |  |||                               |***    ||||                      ||||      | |                                      |  |               | |     | |                    ||||          |  |                  |  |           | |       |  |       | |     ***                                         ***          | |                                      |  |             | |       | |                                | |         | |         | |         | |                        ***                                           | |          | |             | |        |  |     | |     ..gammaturn..               | |       |  |          | | |                                                                     | |                                                              |  |      | |          | | |  |        | |             ..gammaturn..           | |                             | |  ||  |         |  |        |  |      | |  ..                   
search RasMol script viewer Motif-ligand binding stats  nest ..           | |                     | |                              |  |          ***         | |            | |    | |       ****                  *****     | |        |  |                      |  ***                               |  |    ****                      ****      ***                                      |  |               | |     | |                    ****          |  |                  |  |           | |       |  |       | |                                                              | |                                      |  |             ***       ***                                ***         ***         | |         | |                                                                      ***          ***             ***        |  |     | |     ..nest..               ***       |  |          | | |                                                                     ***                                                              |  |      ***          *** |  |        ***             ..nest..           ***                             ***  ||  |         |  |        |  |      | |  ..                   
search RasMol script viewer Motif-ligand binding stats  niche ..           ***                     ***                              ****                      ***            ***    ***                                       ***        ****                      |   |                                ****                                                                                 ****               ***     ***                                  ****                  ****           ***       ****       ***                                                              ***                                      ****                                                                                  ***         ***                                                                                                              ****     ***     ..niche..                         ****          *****                                                                                                                                      ****                       ****                        ..niche..                                                |****         ****        ****      ***  ..                   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                                                                                                                   *****                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             ..stmotif..                                                                                                                                                                                                                                         ..stmotif..                                                |   |                                    ..                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     ..ststaple..                                                                                                                                                                                                                                         ..ststaple..                                                *****                                    ..                   

chain D : WD REPEAT-CONTAINING PROTEIN 42A
member of: PANTHER:searchPTHR15574/searchPTHR15574_SF30UniProt:searchQ5TAQ9
sec str:  ....hhhhhhh....
sequence :  ..QALPALRERELGS
seq num:  ..153          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  ********** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..  **** ****  

   New search    3i8e:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors