triangle PDBeMotif: 3hs5  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.14.99.1
Classification oxidoreductase    | release date: Wed, Jun 10, 2009
Title x-ray crystal structure of arachidonic acid bound to the cyclooxygenase channel of cyclooxygenase-2
Authors A.J.VECCHIO, D.M.SIMMONS, M.G.MALKOWSKI
Method X-RAY DIFFRACTION (resolution: 2.10Å)
PDBe Citation   
Small molecules:    search NAG NAG binding statistics NAG   search BOG BOG binding statistics BOG   search COH COH binding statistics COH   search ACD ACD binding statistics ACD   search MAN MAN binding statistics MAN   search AKR AKR binding statistics AKR   search EDO EDO binding statistics EDO
Modified residues:  search ASN ASN binding statistics ASN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
HHHHHHPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPF
LRSLIMKYVLTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREF
IPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKYQVIGGEVYPPTVK
DTQVEMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWGDEQLFQTSRLILIGETIKIVIED
YVQHLSGYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFT
RQIAGRVAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKALYSDIDVMELYPAL
LVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNNVKGCPFTSFNVQDPQP
TKTATIAASASHSRLDDINPTVLIKRRSTEL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROSTAGLANDIN G/H SYNTHASE 2
member of: CATH:search1.10.640.10/search2.10.25.10GENE3D:searchG3DSA_1.10.640.10/searchG3DSA_2.10.25.10PANTHER:searchPTHR11903/searchPTHR11903_SF8PFAM:searchPF03098PRINTS:searchANPEROXIDASEPROSITE PROFILES:searchPS50026/searchPS50292, SMART:searchSM00181SUPERFAMILY:searchSSF48113/searchSSF57196UniProt:searchQ05769
JMol viewer RasMol script viewer  EDO 9B  ..                                                                                                                 *                                                                              *                                                                                                                                                                                                                                                                                                                                                                       
JMol viewer RasMol script viewer  EDO 7B  ..                                                                                                                 |                                                                              |                                                                                                                                                                                                                                                                                                                                  **                                   
JMol viewer RasMol script viewer  BOG 703B  ..                                                                                                                 |                                 **  * *                                      |                                                                                                                                                                                                                     *                                               *   *                                                        ||                                   
JMol viewer RasMol script viewer  NAG 672B  ..                                                                                                                 |                                 ||  | |                                      |                                                                                                                                                                                                                     |                                               |   |                                                        ||                                   
JMol viewer RasMol script viewer  NAG 671B  ..                                                                                                                 |                                 ||  | |                                      |             *                                                                                                                                                                                                       |                                               |   |                                                        ||                                   
JMol viewer RasMol script viewer  EDO 12A  ..                                                                                                                 |                                 ||  | |                                      |             |                                                                     *                              *                                                                                                  |                                               |   |                                                        ||             *   **  *             
JMol viewer RasMol script viewer  EDO 5A  ..                         **                                                                                      |                                 ||  | |                                      |             |                                                                     |                              |                                                                                                  |                                               |   |                                                        ||             |   ||  |             
JMol viewer RasMol script viewer  EDO 4A  ..                         ||                                                                                      |                **       *       ||  | |                                      |             |                                                                     |                              |                                                                                                  |                 *  **                         |   |                                                        ||             |   ||  |             
JMol viewer RasMol script viewer  EDO 620A  ..                         ||                              *                                                       |                ||       |       ||  | |      *                               |             |                                                                     |                              |            *                                                                                     |                 |  ||                         |   |                      *  ***    *                       ||             |   ||  |             
JMol viewer RasMol script viewer  BOG 703A  ..                         ||                              |                                                       |                ||       |       **  ***      |                               |             |                                                                     |                              |            |                                                                                     *   *             |  ||                         *   *                      |  |||    |                       ||             |   ||  |             
JMol viewer RasMol script viewer  NAG 681A  ..                         ||                              |                                                       |                ||       |       ||  |||      |                               |             |                                                                     |                              |            |                                                     *   * **  *                     |   |             |  ||                         |   |                      |  |||    |                       ||             |   ||  |             
JMol viewer RasMol script viewer  NAG 672A  ..                         ||                              |                                                       |                ||       |       ||  |||      |                       *       |             |                                                                     |                              |            |                                                     |   | ||  |                     |   |             |  ||                         |   |                      |  |||    |                       ||             |   ||  |             
JMol viewer RasMol script viewer  NAG 671A  ..                         ||                              |                                                  *   **              ||       |       ||  |||      |                       *   *   |             |                                                                     |                              |            |                                                     |   | ||  |                     |   |             |  ||                         |   |                      |  |||    |                       ||             |   ||  |             
JMol viewer RasMol script viewer  NAG 661A  ..                      *  ||       **                     |                                                  |   || |              ||       |       ||  |||      |                       |   |   |             |                                                                     |                              |            |                                                     |   | ||  |                     |   |             |  ||                         |   |                      |  |||    |                       ||             |   ||  |             
JMol viewer RasMol script viewer  COH 619A  ..                      |  ||       ||                     |                                                  |   || |              ||       |       ||  |||      |         **   *  * * * |   |   |             |                                                        *            |                              |            |                             *  ****  *              |   | ||  |                     |   |    *        |  ||                         |   |                      |  |||    |                       ||             |   ||  |             
JMol viewer RasMol script viewer  AKR 3A  ..                      |  ||       ||                     |                                                  |   || |              ||       |       ||  |||      |         ||   |  | | | |   |   |             |**                              **                      |            |                              |            |                             |  ||||  |              |   | ||  |                     |   |    |        |  ||                         |   |                      |  |||    |                       ||             |   ||  |             
JMol viewer RasMol script viewer  AKR 2A  ..                      |  ||       ||                     |                                                  |   || |              ||       |       ||  |||      |         ||   |  | | | |   |   |             |||                              ||                      |            |                              |            |                             |  ||||  |              |   | ||  |                     |   |    |        |  ||                ***      |   | *                    |  |||    |                       ||             |   ||  |             
JMol viewer RasMol script viewer  ACD 1A  ..                      |  ||       ||                     |                          **  *                   |   || |              ||       |       ||  |||      |         || * |  | | | |   |   |             |||                              ||                      |            |                              |        **  |* *                          |  *|*|  |              |   | ||  |                     |   |    |        |  ||                |||      |   | |                    |  ||*    *  **  **               ||             |   ||  |             
sec str:  ...............eeee.....eeee.....ee.....eehhhhhhhhhhh.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhh............................hhhhhhhhhh............hhhhhhhhhhhhh......................hhhhhh.hhhhhhhhh.........eee..eee..hhhhhh.........hhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhh..........hhhhhhhh.hhhhh...eee..eeehhhhhh.hhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhh...hhhhhhhhh......hhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhh.hhhhhhhhhh...........
sequence :  ..HHPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRSLIMKYVLTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKYQVIGGEVYPPTVKDTQVEMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIAGRVAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKALYSDIDVMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNNVKGCPFTSFNVQ
seq num:  ..33        43        53        63        73        83        93        103       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  | |        || ||   | |||||   ^*** |      |  | |   ||   | | |    |  |        ||  ||||  |      | ||   || |||^***        |  | |  | |  |   | |     | |      | ||||   |  |   ||  |  | |||  || | | ||||||    |   ||  || |        |  |    | ||| ||   |  ||  ||  | | ||| |  |                     |  |   |   | |      | |          | | |        |  |                  |  |     || |  | |  | ^***         |  || |        | | |  |     |   || ||| |  || | ||||  | ||  | |           |||| |     |  |  |  |    |  | |   ||| | |||| |  | |  ||||   || | ||      |  | ||   |    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   |  | |        || ||   | |||||   |||| |      |  | |   ||   | | |    |  |        ||  ||||  |      | ||   || |||| ||        |  | |  | |  |   | |     | |      | ||||   |  |   ||  |  | |||  || | | ||||||    |   ||  || |        |  |    | ||| ||   |  ||  ||  | | ||| |  |                     |  |   |   | |      | |          | | |        |  |                  |  |     || |  | |  | | |          |  || |        | | |  |     |   || ||| |  || **^*||  | ||  | |           |||| |     |  |  |  |    |  | |   ||| | |||| |  | |  ||||   || | ||      |  | ||   |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  | |        || ||   | |||||   |||| |      |  | |   ||   | | |    |  |        ||  ^**|  |      | ||   || |||| ||        |  | |  | |  |   | |     | |      | ||||   |  |   ||  |  | |||  || | | ||||||    |   ||  || |        |  |    ^**|| ||   |  ||  ||  | | ||| |  |                     |  |   |   ^**      ^**          | | |        |  |                  |  |     || |  ^**  | | |          |  || |        | | |  |     |   || ||| |  ||   |^**  | ||  | |           |||| |     |  |  |  |    |  | |   ^** | |||| |  | |  ||||   || | ||      |  | ||   |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  | |        ^***|   | |||||   ||^***      |  | |   ||   | | |    |  |        ||  || |  |      | ||   || |||| ||        |  | |  | |  |   | |     | |      | ||||   |  |   ||  |  | |||  || | | ||||||    |   ||  || |        |  |    ^***^***   |  ||  ||  | | ||| |  |                     |  |   |   |                     | | |        |  |                  |  |     || |    |  | | |          |  || |        | | |  |     |   || ||| ^***|   | |   ^***  | |           ^*** |     |  |  |  |    ^*** |   ||  | |||| |  | |  ||||   || | ||      |  | ||   |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  | |         |  |   | |||||   ||||        |  | |   ||   | | |    |  |        ||  || |  |      | ||   || |||| ||        |  | |  ^*****   | |     | |      | ||||   |  |   ||  |  | |||  || ^*****||||    |   ||  || |        |  |    |   | |    |  ||  ||  | | ||^*****                     |  |   |   |                     | | |        |  |                  |  |     || |    |  | | |          |  || |        | | |  |     |   || ||| |   |   | |     |   | |            ||| |     |  |  |  |         ^*****  | ^*****  | |  ||^*****| | ||      |  | ^*****    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  | |         |  |   | |||||   ||||        |  | |   ||   | | |    |  |        ||  || |  |      | ||   || |||| ||        |  | |  | |      | |     | |      | ||||   |  |   ||  |  *****  || | | | ||||    |   ||  || |        |  |    |   | |    |  |*****  | | ||  |                        |  |   |   |                     | | |        |  |                  |  |     || |    |  | | |          |  || |        | | |  |     |   || ||| |   |   | |     |   | |            ||| |     |  |  |  |         |   |   |  ||| |  | |  || |    | | ||      |  |  |        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   |  | |         |  |   | |||||   ||||        |  | |   ||   | | |    |  |        ||  || |  |      | ||   || |||| ||        |  | |  | |      | |     | |      **********  |   ||  |  *****  || | | | ||||    |   ||  || |        |  |    |   | |    |  ||  |   | | ||  |                        |  |   |   |                     | | |        |  |                  |  |     || |    |  | | |          |  || |        | | |  |     |   || ||| |   |   | |     |   | |            ||| |     |  |  |  |         |   |   |  ||| |  | |  || |    | | ||      |  |  |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |  | |         |  |   | |||||   ||||        |  | |   ||   | | |    |  |        ||  || |  |      ***|   || |||***|        |  | |  | |      ***     | |      ***||       |   ||  |  ***||  || | | | ||||    |   ||  || |        |  |    |   | |    |  ||  |   | | ||  |                        |  |   |   |                     | | |        |  |                  |  |     || |    |  | ***          |  || |        | | |  |     |   || ||| |   |   | |     |   | |            *** |     |  |  |  |         |   |   |  *** |  | |  || |    | | ||      |  |  |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..   **** |         |  |   | |||||   ||||        |  | |   ||   | | |    |  |        ||  || |  |      |  |   || ||||  |        |  | **** |              | |      ****|       |   ||  |  ****|  || | | | ||||    |   ||  || |        ****    |   | |    |  |****   | | ||  |                        |  |   |   |                     | | |        ****                  |  |     ****    |  |              |  || |        | | ****     |   |****| |   |   | |     |   | |             |  |     |  |  ****         |   |   |  |****  | |  || |    | | ||      |  ****        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      | |         |  |   | |||||   ||||        |  | |   ||   | | |    |  |        ||  || |  |      |  |   || ||||  |        |  |    | |              | |        | |       |   ||  |      |  || | | | ||||    |   ||  || |                |   | |    |  |       | | ||  |                        |  |   |   |                     | | |        |  |                  |  |      | |    |  |              |  || |        | |          |   |  | | |   |   | |     |   | |             |  |     |  |  |  |         |   |   |  ||  |  ***  || |    | | ||      |  |           
search RasMol script viewer Motif-ligand binding stats  nest ..      | |         |  |   | |****   ****        |  | |   ||   | ***    |  |        ||  || |  |      |  |   || ||||  |        |  |    | |              | |        ***       |   ||  |      |  || | *** ****    |   ||  |***                |   ***    |  |       | | ||  |                        |  |   |   |                     *** |        |  |                  |  |      | |    |  |              |  || |        ***          |   |  *** |   |   ***     |   ***             |  |     |  |  |  |         |   |   |  ||  |  |    |***    | | ||      |  |           
search RasMol script viewer Motif-ligand binding stats  niche ..      ***         ****   *** | |    ***        **** |   ||   |        ****        ||  || ****      ****   || *******        ****    ***              ***                  |   |****      ****| |             |   |****                   |   | |    ****       *** |****                        ****   |   |                       ***        ****                  ****      ***    ****              |  ****                     |   |      |   |           |   | |             ****     ****  ****         |   |   ********  |    |***    | ****      ****           
search RasMol script viewer Motif-ligand binding stats  stmotif ..                             | |                    *****|   |                    ||  ||                  *****|                                                          |   |              | |             *****                       ***** |                   |                                   |   |                                                                                           |   |                       |   |      *****           |   | |                                         |   |             |    |       |   |                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                             | |                         *****                    ******                   *****                                                          *****              | |                                         ***** |                   |                                   *****                                                                                           *****                       *****                      ***** |                                         *****             ******       *****                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                             ***                                                                                                                                                             ***                                             ***                   |                                                                                                                                                                                              ***                                                                                                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                                                                   *                                                                                                                                                                                                                                                                                                    

chain B : PROSTAGLANDIN G/H SYNTHASE 2
member of: CATH:search1.10.640.10/search2.10.25.10GENE3D:searchG3DSA_1.10.640.10/searchG3DSA_2.10.25.10PANTHER:searchPTHR11903/searchPTHR11903_SF8PFAM:searchPF03098PRINTS:searchANPEROXIDASEPROSITE PROFILES:searchPS50026/searchPS50292, SMART:searchSM00181SUPERFAMILY:searchSSF48113/searchSSF57196UniProt:searchQ05769
JMol viewer RasMol script viewer  EDO 11B  ..                                                                                                                                                                                                                *  *                          ***                                                                                                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  EDO 10B  ..                                                                                                                                                                                                                |  |   *                      |||                                                    **                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  EDO 9B  ..                                                                                                               * *                                                                                              |  |   |                      |||                                                    ||                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  EDO 8B  ..                                                                                                               | |                                                                                              |  |   |                      |||                                   *  *             ||            *                                                                                                                                                                                                                                  **  *            
JMol viewer RasMol script viewer  EDO 7B  ..               *       * *                                                                                     | |                                                                                              |  |   |                      |||                                   |  |             ||            |                                                                                                                                                                                                                                  ||  |            
JMol viewer RasMol script viewer  EDO 6B  ..               |       | |                                                                                     | |                *        *                                                                    |  |   |                      |||                                   |  |             ||            |                                                                                                                    *  **                                                                                                         ||  |            
JMol viewer RasMol script viewer  EDO 3B  ..               |       | |                                                                                     | |                |        |                                                                    |  |   |   *  *      *        |||                                   | *|             ||            |                                                                                                                    |  ||                                                                                                         ||  |            
JMol viewer RasMol script viewer  EDO 2B  ..               |       | |                               *                                                     | |                |        |                    *                                               |  |   |   |  |      |        |||                                   | ||             ||            |            *                                                                                                       |  ||                                                    *  ***    *                                          ||  |            
JMol viewer RasMol script viewer  NAG 681B  ..               |       | |                               |                                                     | |                |        |                    |                                               |  |   |   |  |      |        |||                                   | ||             ||            |            |                                                     *   *  *  *                                       |  ||                                                    |  |||    |                                          ||  |            
JMol viewer RasMol script viewer  NAG 672B  ..               |       | |                               |                                                     | |                |        |                    |                       *                       |  |   |   |  |      |        |||                                   | ||             ||            |            |                                                     |   |  |  |                                       |  ||                                                    |  |||    |                                          ||  |            
JMol viewer RasMol script viewer  NAG 671B  ..               |       | |                               |                                                  *  |**              |        |                    |                       *   *                   |  |   |   |  |      |        |||                                   | ||             ||            |            |                                                     |   |  |  |                                       |  ||                                                    |  |||    |                                          ||  |            
JMol viewer RasMol script viewer  NAG 661B  ..               |      *| |        **                     |                                                  |  ||| |              |        |                    |                       |   |                   |  |   |   |  |      |        |||                                   | ||             ||            |            |                                                     |   |  |  |                                       |  ||                                                    |  |||    |                                          ||  |            
JMol viewer RasMol script viewer  COH 619B  ..               |      || |        ||                     |                                                  |  ||| |              |        |                    |      *  **   *  ***   |   |                   |  |   |   |  |      |        |||                      *            | ||             ||            |            |                             *  ** *  *              | * |  |  |                              *      * |  ||                                                    |  |||    |                                          ||  |            
JMol viewer RasMol script viewer  ACD 1B  ..               |      || |        ||                     |                                                  |  ||| |              |        |                    |      |  || * | *|||   |   |       *           |  |   |   |  |      |        |||                      |            | ||             ||            |    *   **  ** *                     *   *|  *|*|  |              | | |  |  |                              |      | |  ||                                                    |  |||    *  **  ** **                               ||  |            
JMol viewer RasMol script viewer  EDO 5A  ..               |      || |        ||                     |                                                  |  ||| |              |        |                    |      |  || | | ||||   |   |       |           |  |   |   |  |      |        |||                      |            | ||             ||            |    |   ||  || |                     |   ||  ||||  |              | | |  |  |                              |      | |  ||                                                    |  |||    |  ||  || ||                  *            ||  |            
JMol viewer RasMol script viewer  MAN 673A  ..               |      || |        ||                     |                                                  |  ||| |              |        |                    |      |  || | | ||||   |   |       |           |  |   |   |  |      |        |||                      |            | ||             ||            |    |   ||  || |                     |   ||  ||||  |              | | |  |  |                              |      | |  ||                                                    |  |||    |  ||  || ||                  |            ||  |            
JMol viewer RasMol script viewer  NAG 672A  ..               |      || |        ||                     |                                                  |  ||| |              |        |                    |      |  || | | ||||   |   |       |          *|  |   |   |  |      |        |||                      |            | ||             ||            |    |   ||  || |                     |   ||  ||||  |              | | |  |  |                              |      | |  ||                                                    |  |||    |  ||  || ||                  |            ||  |            
JMol viewer RasMol script viewer  NAG 671A  ..               |      || |        ||                     |                                                  |  ||| |              |        |                    |      |  || | | ||||   |   |       |         *||  |   |   |  |      |        |||                      |            | ||             ||            |    |   ||  || |                     |   ||  ||||  |              | | |  |  |                              |      | |  ||                                                    |  |||    |  ||  || ||                  |            ||  |            
sec str:  ...............eeee.....eeee.....ee.....eehhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.........ee......hhhhhhh....ee......................hhhhhhhhhh............hhhhhhhhhhhhh......................hhhhhh.hhhhhhhhh.........eee..eee..hhhhhh.........hhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhh..........hhhhhhhhhhhhhh...eee..eeehhhhhh..hhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhh...hhhhhhhhh......hhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhh.hhhhhhhhhh..........
sequence :  ..HHPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRSLIMKYVLTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKYQVIGGEVYPPTVKDTQVEMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIAGRVAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKALYSDIDVMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNNVKGCPFTSFNV
seq num:  ..33        43        53        63        73        83        93        103       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  | |        || ||   | |||||   ^*** |      |  |      | | ||| |   || ||        ||  ||||  |      |  |   || |||^***        |  | |  | |  |           | |      | ||||   |  |   ||  |      |  || | | ||||||||  |   ||  || |        |  |    | ||| ||   |  ||  ||  | | ||| |  |                     |  |       | |      | |          | | |      | || |                  |  |     || |  | | || ^***         |  || |        | |          |   || ||| |  |  | ||||  |||| || |           |||| |     |  |  |  |    |  | |   ||| | |||| |  | |  ||||   || | ||      |  | ||   |   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   |  | |        || ||   | |||||   |||| |      |  |      | | ||| |   || ||        ||  ||||  |      |  |   || |||| ||        |  | |  | |  |           | |      | ||||   |  |   ||  |      |  || | | ||||||||  |   ||  || |        |  |    | ||| ||   |  ||  ||  | | ||| |  |                     |  |       | |      | |          | | |      | || |                  |  |     || |  | | || |            |  || |        | |          |   || ||| |  |  **^*||  |||| || |           |||| |     |  |  |  |    |  | |   ||| | |||| |  | |  ||||   || | ||      |  | ||   |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  | |        || ||   | |||||   |||| |      |  |      | | ||| |   || ||        ||  ^**|  |      |  |   || |||| ||        |  | |  | |  |           | |      | ||||   |  |   ||  |      |  || | | ||||||||  |   ||  || |        |  |    ^**|| ||   |  ||  ||  | | ||| |  |                     |  |       ^**      ^**          | | |      | || |                  |  |     || |  ^** || |            |  || |        | |          |   || ||| |  |    |^**  |||| || |           |||| |     |  |  |  |    |  | |   ^** | |||| |  | |  ||||   || | ||      |  | ||   |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  | |        ^***|   | |||||   ||^***      |  |      | | ||| |   || ||        ||  || |  |      |  |   || |||| ||        |  | |  | |  |           | |      | ||||   |  |   ||  |      |  || | | ||||||||  |   ||  || |        |  |    ^***^***   |  ||  ||  | | ||| |  |                     |  |                             | | |      | || |                  |  |     || |  | | || |            |  || |        | |          |   || ||| ^***    | |   ^*** || |           ^*** |     |  |  |  |    ^*** |   ||  | |||| |  | |  ||||   || | ||      |  | ||   |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  | |         |  |   | |||||   ||||        |  |      | | ||| |   || ||        ||  || |  |      |  |   || |||| ||        |  | |  ^*****           | |      | ||||   |  |   ||  |      |  || ^*****||||||  |   ||  || |        |  |    |   | |    |  ||  ||  | | ||^*****                     |  |                             | | |      | || |                  |  |     || |  | | || |            |  || |        | |          |   || |||         | |    ||  || |            ||| |     |  |  |  |         ^*****  | ^*****  | |  ||^*****| | ||      |  | ^*****   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  | |         |  |   | |||||   ||||        |  |      | | ||| |   *****        ||  || |  |      |  |   || |||| ||        |  | |  | |              | |      | ||||   |  |   ||  |      |  || | | | |*****  |   ||  || |        |  |    |   | |    |  |*****  | | ||  |                        |  |                             | | |      | || |                  |  |     || |  | | || |            |  || |        | |          |   || |||         | |    ||  || |            ||| |     |  |  |  |         |   |   |  ||| |  | |  || |    | | ||      |  |  |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   |  | |         |  |   | |||||   ||||        |  |      | | ||| |   || ||        ||  || |  |      |  |   || |||| ||        |  | |  | |              | |      **********  |   ||  |      |  || | | | |||||   |   ||  || |        |  |    |   | |    |  ||  |   | | ||  |                        |  |                             | | |      | || |                  |  |     || |  | | || |            |  || |        | |          |   || |||         | |    ||  || |            ||| |     |  |  |  |         |   |   |  ||| |  | |  || |    | | ||      |  |  |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |  | |         |  |   ***||||   ||||        |  |      | | ||| |   || ||        ||  || |  |      |  |   || |||***|        |  | |  | |              | |      ***||       |   ||  |      |  || | | | |||||   |   ||  || |        |  |    |   | |    |  ||  |   | | ||  |                        |  |                             | | |      | || |                  |  |     || |  | | || |            |  || |        | |          |   || |||         | |    ||  || |            *** |     |  |  |  |         |   |   |  *** |  | |  || |    | | ||      |  |  |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..   **** |         |  |   | |||||   ||||        |  |      | | ||| |   ****|        ||  || |  |      ****   || ||||  |        |  | **** |              | |      ****|       |   ||  |      |  || | | | |****   |   ||  || |        ****    |   | |    |  |****   | | ||  |                        |  |                             | | |      ******                  |  |     ****  | | ****            |  || |        | |          |   |****|         | |    ||  || |             |  |     |  |  |  |         |   |   |  |****  | |  || |    | | ||      |  ****       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      | |         |  |   | |||||   ||||        |  |      | | ||| |    |  |        ||  || |  |      |  |   || ||||  |        |  |    | |              | |        | |       |   ||  |      |  || | | | ||||    |   ||  || |                |   | |    |  |       | | ||  |                        |  |                             | | |        |  |                  |  |      | |  | | ||              |  || |        | |          |   |  | |         | |    ||  || |             |  |     |  |  |  |         |   |   |  ||  |  ***  || |    | | ||      |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..      | |         |  |   | |****   ****        |  |      | | ||***    |  |        ||  || |  |      |  |   || ||||  |        |  |    | |              | |        ***       |   ||  |      |  || | *** ****    |   ||  |***                |   ***    |  |       | | ||  |                        |  |                             *** |        |  |                  |  |      | |  | | ||              |  || |        ***          |   |  ***         ***    ||  |***             |  |     |  |  |  |         |   |   |  ||  |  |    |***    | | ||      |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..      ***         ****   *** | |    ***        ****      | ****       ****        ||  || ****      ****   || *******        ****    ***              ***                  |   |****      ****| |             |   |****                   |   | |    ****       *** |****                        ****                             | ***        ****                  ****      ***  | ****              |  ****                     |   |                     ||  || |             ****     ****  ****         |   |   ********  |    |***    | ****      ****          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                             | |                         |   |                    ||  ||                  *****|                                                          |   |              | |             *****                       |   | |                   |                                                             | |                                               *****               |   |                       |   |                     *****| |                                         |   |             |    |       |   |                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                             | |                         *****                    ******                   *****                                                          *****              | |                                         ***** |                   |                                                             | |                                                                   *****                       *****                      ***** |                                         *****             ******       *****                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                             ***                                                                                                                                                             ***                                             ***                   |                                                             ***                                                                                                                              ***                                                                                                  
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                                                                   *                                                                                                                                                                                                                                                                                                   

   New search    3hs5:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors