triangle PDBeMotif: 3hnc  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.17.4.1
Classification oxidoreductase    | release date: Sun, May 31, 2009
Title crystal structure of human ribonucleotide reductase 1 bound effector ttp
Authors C.G.DEALWIS, H.XU, J.W.FAIRMAN, S.R.WIJERATHNA
Method X-RAY DIFFRACTION (resolution: 2.41Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search TTP TTP binding statistics TTP   search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAAR
IAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKSTLDIVLANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKIN
GKVAERPQHMLMRVSVGIHKEDIDAAIETYNLLSERWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCAL
ISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHLDIFEFLDLKKNTGK
EEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLDEVWGEEFEKLYASYEKQGRVRKVVKAQQLWYAIIESQTET
GTPYMLYKDSCNRKSNQQNLGTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFKKLAEVTKVVVRNLNKI
IDINYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQIFETIYYGALEASCDLAKEQGPYETYEGSP
VSKGILQYDMWNVTPTDLWDWKVLKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPH
LLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKL
TSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE SUBUNI
member of: GENE3D:searchG3DSA_3.20.70.20PANTHER:searchPTHR11573PFAM:searchPF00317/searchPF02867/searchPF03477PRINTS:searchRIBORDTASEM1PROSITE PATTERNS:searchPS00089, PROSITE PROFILES:searchPS51161, SUPERFAMILY:searchSSF48168/searchSSF51998TIGRFAMS:searchTIGR02506UniProt:searchP23921
JMol viewer RasMol script viewer  TTP 802B  ..                                                                                                                                                                                                                                     *                                         ****..TTP ..                      ..                                                                                                                                                                                                                                                                                                                                                                                                                                 
JMol viewer RasMol script viewer  SO4 809A  ..                                                                                                                                                                                           **                                        |                                         ||||..SO4 ..                      ..                                                                                                                                                                                                                                                                                      * **                                                                                                                                       
JMol viewer RasMol script viewer  SO4 805A  ..                                                                                                                                                                                           ||                                        |                                         ||||..SO4 ..                      ..                                                                                                                                                                                                                                                                                      | ||                                                                               ***                                                     
JMol viewer RasMol script viewer  SO4 804A  ..                                                                                                                          ***                                                              ||                                        |                                         ||||..SO4 ..                      ..                                                                                                                                                                                                                                                                                      | ||                                                                               |||                                                     
JMol viewer RasMol script viewer  TTP 802A  ..                                                                                                                          |||                                                              ||                       ***  *           |            *     ***     *              ||||..TTP ..                      ..                                                                                                                                                                                                                                                                                      | ||                                                                               |||                                                     
JMol viewer RasMol script viewer  MG 801A  ..                                                                                                                          |||                                                              ||                       |||  |           |            |     |||     |              ||||..MG ..                      ..                                                                                                                                                                                                                                                                                      | ||                                                                               |||                                                     
sec str:  ..hhhhhhhhhhh..........hhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..ee..ee..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhh..eeehhhhhhhh.........eeeee....hhhhhhhhhhhhhhhhhh..eeeee.........ee....ee...hhhhhhhhhhhhhhh..... ....eeeee.....hhhhhh........eeeeeeehhhhhhhhhh..eeee.......hhhhhhhhhhhhhhhhhhhh....eeeehhhhhhhhhhhhhhhh..eeeehhhhhhh..hhhhh....................eee.eeeee.hhhh......hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh..eeeeehhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhh.hhhhhh........hhhhhhhhhhhhh...........hhhhhhhhh...........eeeeee..eeeeeehhhhhhhhhhh...hhhhhhhhhhh..........hhhhhhhh......hhhhhhhhhhhhhh.........ee....hhhhhhhhhhhhhhh...eee..ee..
sequence :  ..MFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKSTLDIVLANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHKEDIDAAIETYNLLSERWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQ... ..GAFAIYLEPWHLDIFEFLDLKK..RDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLDEVWGEEFEKLYASYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNLGTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFKKLAEVTKVVVRNLNKIIDINYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQIFETIYYGALEASCDLAKEQGPYETYEGSPVSKGILQYDMWNVTPTDLWDWKVLKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTR
seq num:  ..14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284  ... ..295       305         ..326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       706       716       726       736    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     | | || || |||| | |   | ||| |||  ||  |      |   ||| |         |   | ||  ||||       |  |    | |       |  | |  | |  || |    |  |     |    |||      | |     |   |   |  |           |||||      | || | | | | |   | || |  ||  |||    |  | ||    |  | | ||   || |    |       ^***| |  ..PS00001..       |  |         | ..              |   | ||          |||||              | | ||             |  || |         |  | |   || | || ||||   |||||   |       |  |  | |     |   |        | |  | |       | |          | |  || ||||  |   |   |       ||    |          | ||||   | |     | || |||||||         |    |     || |    |||^***|       | |         | | |   | ||||          |^***||| ||     |  ||||||| |         |  |             |   |         ||| | |      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     | | || || |||| | |   | ||| |||  ||  |      |   ||| |         |   | ||  ||||       |  |    | |       |  | |  | |  || |    |  |     |    |||      | |     |   |   |  |           |||||      | || | | | | |   | || |  ||  |||    |  | ||    |  | | ||   || |    |         ||| |  ..PS00004..       |  |         **..              |   | ||          |||||              | | ||             |  || |         |  | |   || | || ||||   |||||   |       |  |  | |     |   |        | |  | |       | |          | |  || ||||  |   |   |       ||    |          | ||||   | |     | || |||||||         |    |     || |    ||| ||||       | |         | | |   | ||||          | |||||| ||     |  ||||||| |         |  |             |   |         ||| | |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     ^** || || |||| | |   ^**|| |||  ||  |      |   ||^**         |   | ||  ^**|       |  |    | |       |  | |  | |  || |    |  |     |    |||      | |     |   |   |  |           ^**||      | || ^** | | |   ^**| |  ||  ^**    |  | ||    |  | | ||   || |    |         ^** |  ..PS00005..       |  |           ..              |   | ||          |||||              | | ||             |  || |         |  | |   |^** || ||||   ^**||   |       |  |  | |     |   |        | |  | |       ^**          | |  || ||||  |   |   |       ||    |          | ||||   | |     | || |||||||         |    |     || |    ||| ||||       ^**         | | |   ^**|||          | |||||| ||     |  ||||||^**         |  |             |   |         ||| | |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         || || |||| | |   |  || |||  |^***      |   ||  |         |   | ||  || |       |  |    | |       ^*** |  | |  || |    |  |     |    |||      | |     |   |   |  |            ||||      | || |   | | |   ^*** |  ||   |     |  | ||    |  | | ||   || |    |          |  |  ..PS00006..       |  |           ..              |   ^***          |||||              | | ||             ^***| |         |  | |   |    || ||||   ^***|   |       |  |  | |     |   |        | |  | |                    | |  || ||||  |   |   |       ||    |          | ||||   | |     | |^***|||||         |    |     || |    ||| ||||                   | | |   | ||||          | ||||^***|     |  |^***|            |  |             |   |         ||| | |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         || || |||| | |   |  || |||  |          |   ||  |         |   | ||  || |       |  |    | |            |  | |  || |    |  |     ******^|      | |     |   |   |  |            ||||      | || |   | | |        |  ||   |     |  | ||    |  | | ||   || |    |          |  |  ..PS00007..       |  |           ..              |   | |           |||||              | | ||                 | |         |  | |   |    || ||||    | ||   |       |  |  | |     |   |        *******^                    | |  || ||||  |   |   ********^|    |          | ||||   | |     | |  | |||||         |    |     || |    ||| ||||                   | | |   | ||||          | |||| |  |     |  ||||||            |  |             |   |         ||| | |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         || || |||| | |   |  || ^*****          |   ||  |         |   | ||  || |       |  |    | |            |  | |  || |    |  |          | |      | |     |   |   |  |            ||||      | || |   | | |        |  ^*****     |  | |^*****  | | ^*****| ^*****          |  |  ..PS00008..       |  |           ..              |   | |           |||||              | | ||                 | |         |  | |   ^*****| ||||    | ||   |       |  |  | |     |   |          |  |                      ^*****| ||||  |   |            ^*****          | ||^***** |     | |  | |||||         ^*****     || |    |^*****|                   | | |   | ||||          | ^*****  |     |  ||||||            |  |             |   |         |^*****      
search RasMol script viewer Motif-ligand binding stats  RIBORED_LARGE ..         || || |||| | |   |  || |||  |          |   ||  |         |   | ||  || |       |  |    | |            |  | |  || |    |  |          | |      | |     |   |   |  |            ||||      | || |   | | |        |   |         |  | |     |  | |  |    | |               |  |  ..PS00089..       |  |           ..              |   | |           |||||              | | ||                 | |         |  | |         | ||||    | ||   |       |  |  | |     |   |          |  |                      | |   | ||||  |   |                            | || |   | |     | |  | |||***********************| |    | | || |                   | | |   | ||||          | |||| |  |     |  ||||||            |  |             |   |         | | |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         || || |||| | |   |  || |||  |          |   ||  |         |   | ||  || |       |  |    | |            |  | |  || |    |  |          | |      | |     |   |   |  |            ||||      | || |   | | |        |   |         |  | |     |  | |  |    | |               |  |  ..alphabetamotif..       |  |           ..              |   | |           |||||              | | ||                 | |         |  | |         | ||||    | ||   |       |  |  | |     |   |          |  |                      | |   | ||||  |   |                            | || |   | |     | |  | ||| |                     | |    | | || |                   | | |   | ||||          | |||| |  |     |  |*****            |  |             |   |         | | |        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         || || |||| | |   |  || |||  |          |   ||  |         |   | ||  || |       |  |    | |            |  | |  || |    |  |          | |      | |     |   |   |  |            ||||      | || |   | | |        |   |         |  | |     |  | |  |    | |               |  |  ..asxmotif..       |  |           ..              |   | |           |||||              | | ||                 | |         |  | |         | ||||    | ||   |       |  |  | |     |   |          |  |                      | |   | ||||  |   |                            | || |   | |     | |  | ||| |                     | |    | | || |                   | | |   | ||||          | |||| |  |     |  ||||||            |  |             *****         | | |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..         || || |*** | |   |  || |||  |          |   ||  |         |   | ||  || |       |  |    ***            |  | |  || |    |  |          | |      | |     |   |   |  |            ||||      | || |   | | |        |   |         |  | |     |  | |  |    | |               |  |  ..asxturn..       |  |           ..              |   | |           |||||              | | ||                 | |         |  | |         | ||||    | ||   |       |  |  | |     |   |          |  |                      | |   | ||||  |   |                            | || |   | |     | |  | ||***                     | |    | | || |                   *** |   | ||||          | |||| |  |     |  ||||||            |  |                           | | |        
search RasMol script viewer Motif-ligand binding stats  betabulge ..         || || | |  | |   |  || |||  |          |   ||  |         |   | ||  || |       |  |    | |            |  | |  || |    |  |          | |      | |     |   |   |  |            ||||      | || |   | | |        |   |         |  | |     |  | |  |    | |               |  |  ..betabulge..       |  |           ..              |   | |           |||||              | | **                 | |         |  | |         | ||||    | ||   |       |  |  | |     |   |          |  |                      | |   | ||||  |   |                            | || |   | |     | |  | ||                        | |    | | || |                       |   | ||||          | |||| |  |     |  ||||||            |  |                           | | |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ******* |  | |   |  ****||  |          |   |****         |   | ||  || |       |  |    | |            **** |  || |    |  |          | |      | |     |   |   ****            ||||      | || |   | | |        |   |         **** |     |  | ****    | |               |  |  ..betaturn..       ****           ..              |   | |           ****|              | |                    | |         |  | |         | ||||    | ||   |       |  |  | |     |   |          |  |                      | |   ****||  |   |                            | || |   | |     | |  | ||                        | |    | | ****                       |   ****||          ****|| |  |     |  |****|            ****                           | | |        
search RasMol script viewer Motif-ligand binding stats  nest ..          | || | |  | |   |   |  ||  |          |   |             |   | ||  || |       |  |    ***                 |  || |    |  |          | |      | |     |   |                   ****      | || |   | | |        |   |            ***     |  | |  |    ***               |  |  ..nest..       |  |           ..              |   ***           *** |              ***                    ***         |  | |         | ****    | ||   |       |  |  ***     |   |          |  |                      ***     ***|  |   |                            | || |   ***     ***  | ||                        ***    ***  | |                       |   | ****          ***||| |  |     |  |||| |            |  |                           *** |        
search RasMol script viewer Motif-ligand binding stats  niche ..          ****** **** |   |   ********          |   |             |   | |*******       ****                        |  ****    ****          ***      ***     |   |                             ******   *** |        |   |                    **** ****    | |               ****  ..niche..       ****           ..              |   |              ****                                     | |         **** |         | |***    ****   |       ****          |   |          ****                                 ****   |                            ******   |            ****                                    ***                       |   |  ***             |*******     ****|****            ****                             ***        
search RasMol script viewer Motif-ligand binding stats  stmotif ..                      |   |                     |   |             |   | |   |                                      |   |                                     |   |                                          |        *****                                 | |                     ..stmotif..                      ..              |   |                                                       | |            | |         | | |     | |    |                     |   |                                                  *****                                 *****            | |                                                               |   |                  | |              *****                                                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                      *****                     *****             ***** *****                                      *****                                     *****                                          |                                              | |                     ..ststaple..                      ..              *****                                                       | |            | |         | | |     | |    |                     *****                                                                                                         | |                                                               *****                  | |              | |                                                          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                            |                                              ***                     ..stturn..                      ..                                                                          ***            ***         | | |     ***    |                                                                                                                                   ***                                                                                      ***              ***                                                          
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                            *                                                                      ..REP00000..                      ..                                                                                                     * * *            *                                                                                                                                                                                                                                                                                                          

chain B : RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE SUBUNI
member of: GENE3D:searchG3DSA_3.20.70.20PANTHER:searchPTHR11573PFAM:searchPF00317/searchPF02867/searchPF03477PRINTS:searchRIBORDTASEM1PROSITE PATTERNS:searchPS00089, PROSITE PROFILES:searchPS51161, SUPERFAMILY:searchSSF48168/searchSSF51998TIGRFAMS:searchTIGR02506UniProt:searchP23921
JMol viewer RasMol script viewer  SO4 807B  ..                                                                                                                                                                                                         *                                                                                         ..SO4 ..                                                                                                                                                                                                                                                                                                                     *****                      ..SO4 ..                                                                                                               
JMol viewer RasMol script viewer  SO4 806B  ..    **                                              *                                                                                                                                                    |                                                                                         ..SO4 ..                                                                                                                                                                                                                                                                                                                     |||||                      ..SO4 ..                                                                                                               
JMol viewer RasMol script viewer  SO4 803B  ..    ||                                              |                                                                                                                                                    |                                                                                         ..SO4 ..                                                                                                                                                                                                                                                                                                                     |||||                      ..SO4 ..                                                       ***                                                     
JMol viewer RasMol script viewer  TTP 802B  ..    ||                                              |                                                                                                                                                    |                       ***  *                       **     ***    **                     ..TTP ..                                                                                                                                                                                                                                                                                                                     |||||                      ..TTP ..                                                       |||                                                     
JMol viewer RasMol script viewer  MG 801B  ..    ||                                              |                                                                                                                                                    |                       |||  |                       ||     |||    ||                     ..MG ..                                                                                                                                                                                                                                                                                                                     |||||                      ..MG ..                                                       |||                                                     
JMol viewer RasMol script viewer  TTP 802A  ..    ||                                              |                                                                                                                                                    |                       |||  |           *           ||     |||    ||              *****  ..TTP ..                                                                                                                                                                                                                                                                                                                     |||||                      ..TTP ..                                                       |||                                                     
sec str:  ...eee.....eee.hhhhhhhhhhh..........hhhhhhhhhhhh....eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..ee..ee..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhh..eeehhhhhhhh.........eeeee....hhhhhhhhhhhhhhhhhh..eeeee.........ee....ee..hhhhhhhhhhhhhhhh........ .....eeeee.....hhhhhh................eeeeeehhhhhhhhhhh.eeee.......hhhhhhhhhhhhhhhhhhhh....eeeehhhhhhhhhhhhhhhh..eeeehhhhhhh..hhhhh....................eee.eeeee.hhhh......hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh..eeeeehhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhh.hhhhhh........hhhhhhhhhhhhh...........hhhhhhhhh...........eeee..... ....eeeehhhhhhhhhhh...hhhhhhhhhh...........hhhhhhhh......hhhhhhhhhhhhhh.........ee....hhhhhhhhhhhhhhhh..eee..ee..
sequence :  ..MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKSTLDIVLANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHKEDIDAAIETYNLLSERWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGN... ..PGAFAIYLEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLDEVWGEEFEKLYASYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNLGTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFKKLAEVTKVVVRNLNKIIDINYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQIFETIYYGALEASCDLAKEQGPYETYEGSPVSKGILQYDMWNVTPTDLWDWKVLKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRV... ..GEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTR
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281        ... ..294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624   ... ..632       642       652       662       672       682       692       702       712       722       732        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    | |||     |   | |  | || |||| ||||  | |   | |  || ||  |        || ||               |  ||||       |  |    | |       |  |      |  || |    |  |     |    |||  |  || |     |   |   |  |       |   |||||      | || | |     |   | || |  ||  |||       | ||    |  | | ||   || |    |       ^***|  | |  ..PS00001..        |  |       | |||| ||| ||  |           |   | ||          ||| |              | | ||           | | ||| |         |  | |   || | || ||||   |||||   |       |  |  | | |   |   |        | |  | |       | |          | |  || ||||  |   |   |       ||    |         || |||||| |||     | || |||||||         |    |     |       |||^***|       | | ..PS00001..      | | |   | ||||          |^***||| ||     |  ||||||| | |       |  |                           |||   |      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    | |||     |   | |  | || |||| ||||  | |   | |  || ||  |        || ||               |  ||||       |  |    | |       |  |      |  || |    |  |     |    |||  |  || |     |   |   |  |       |   |||||      | || | |     |   | || |  ||  |||       | ||    |  | | ||   || |    |         | |  | |  ..PS00004..        |  |       | **^* ||| ||  |           |   | ||          ||| |              | | ||           | | ||| |         |  | |   || | || ||||   |||||   |       |  |  | | |   |   |        | |  | |       | |          | |  || ||||  |   |   |       ||    |         || |||||| |||     | || |||||||         |    |     |       ||| ||||       | | ..PS00004..      | | |   | ||||          | |||||| ||     |  ||||||| | |       |  |                           |||   |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | |||     |   ^**  | || |||| ||||  ^**   | |  || ||  |        |^**|               |  ^**|       |  |    | |       |  |      |  || |    |  |     |    |||  |  || |     |   |   |  |       |   ^**||      | || ^**     |   ^**| |  ||  ^**       | ||    |  | | ||   || |    |         ^**  | |  ..PS00005..        |  |       |  | ^**|| ||  |           |   | ||          ||| |              | | ||           | | ||| |         |  | |   |^** || ||||   ^**||   |       |  |  | | |   |   |        | |  | |       ^**          | |  || ||||  |   |   |       ||    |         || |||||| |||     | || |||||||         |    |     |       ||| ||||       ^** ..PS00005..      | | |   ^**|||          | |||||| ||     |  ||||||^** |       |  |                           |||   |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |||     |   |    | || |||| ||||  |     | |  |^***  |        |  ||               |  || |       |  |    | |       ^***      |  || |    |  |     |    |||  |  || |     |   |   |  |       |   |||||      | || |       |   ^*** |  ||   |        | ||    |  | | ||   || |    |              | |  ..PS00006..        |  |       |  | ^***| ||  |           |   ^***          ||| |              | | ||           | ^***| |         |  | |   |    || ||||   ^***|   |       |  |  | | |   |   |        | |  | |                    | |  || ||||  |   |   |       ||    |         || |||||| |||     | |^***|||||         |    |     |       ||| ||||           ..PS00006..      | | |   | ||||          | ||||^***|     |  |^***||   |       |  |                           |||   |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    | |||     |   |    | || |||| ||||  |     | |  |  |   |        |  ||               |  || |       |  |    | |                 |  || |    |  |     ******^|  |  || |     |   |   |  |       |   |||||      | || |       |        |  ||   |        | ||    |  | | ||   || |    |              | |  ..PS00007..        |  |       |  | | ||| ||  |           |   | |           ||| |              | | ||           |   | | |         |  | |   |    || ||||    | ||   |       |  |  | | |   |   |        *******^                    | |  || ||||  |   |   ********^|    |         || |||||| |||     | |  | |||||         |    |     |       ||| ||||           ..PS00007..      | | |   | ||||          | |||| |  |     |  |||||||   |       |  |                           |||   |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |||     |   |    | || |||| ||||  |     ^*****  |   |        |  ||               |  || |       |  |    | |                 |  || |    |  |          | |  |  || |     |   |   |  |       |   |||||      | || |       |        |  ^*****        | |^*****  | | ^*****| ^*****              | |  ..PS00008..        |  |       |  | | ||| ||  |           |   | |           ||| |              | | ||           |   | | |         |  | |   ^*****| ||||    | ||   |       |  |  | | |   |   |          |  |                      ^*****| ||||  |   |            ^*****         || ||^*****||     | |  | |||||         ^*****     |       |^*****|           ..PS00008..      | | |   | ||||          | ^*****  |     |  |||||||   |       |  |                           |^*****      
search RasMol script viewer Motif-ligand binding stats  RIBORED_LARGE ..    | |||     |   |    | || |||| ||||  |       |  |  |   |        |  ||               |  || |       |  |    | |                 |  || |    |  |          | |  |  || |     |   |   |  |       |   |||||      | || |       |        |   |            | |     |  | |  |    | |                   | |  ..PS00089..        |  |       |  | | ||| ||  |           |   | |           ||| |              | | ||           |   | | |         |  | |         | ||||    | ||   |       |  |  | | |   |   |          |  |                      | |   | ||||  |   |                           || || ||| |||     | |  | |||***********************       | | || |           ..PS00089..      | | |   | ||||          | |||| |  |     |  |||||||   |       |  |                           | |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |||     |   |    | || |||| ||||  |       |  |  |   |        *****               |  || |       |  |    | |                 |  || |    |  |          | |  |  || |     |   |   |  |       |   |||||      | || |       |        |   |            | |     |  | |  |    | |                   | |  ..alphabetamotif..        |  |       |  | | ||| ||  |           |   | |           ||| |              | | ||           |   | | |         |  | |         | ||||    | ||   |       |  |  | | |   |   |          |  |                      | |   | ||||  |   |                           || || ||| |||     | |  | ||| |                            | | || |           ..alphabetamotif..      | | |   | ||||          | |||| |  |     |  |*****|   |       |  |                           | |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    | |||     |   |    | || |||| ||||  |       |  |  |   |        |  |                |  || |       |  |    | |                 |  || |    |  |          | |  |  || |     |   |   |  |       |   |||||      | || |       |        |   |            | |     |  | |  |    | |                   | |  ..asxmotif..        |  |       |  | | ||| ||  |           |   | |           ||| |              | | ||           |   | | |         |  | |         | ||||    | ||   |       |  |  | | *****   |          |  |                      | |   | ||||  |   |                           || || ||| |||     | |  | ||| |                            | | || |           ..asxmotif..      | | |   | ||||          | |||| |  |     |  |||||||   |       |  |                           | |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | |||     |   |    | || |*** |***  |       |  |  |   |        |  |                |  || |       |  |    | |                 |  || |    |  |          | |  |  || |     |   |   |  |       |   |||||      | || |       |        |   |            | |     |  | |  |    | |                   | |  ..asxturn..        |  |       |  | | ||| ||  |           |   | |           ||| |              | | ||           |   | | |         |  | |         | ||||    | ||   |       |  |  | |     |   |          |  |                      | |   | ||||  |   |                           || || ||| |||     | |  | ||***                            | | || |           ..asxturn..      *** |   | ||||          | |||| |  |     |  |||||||   |       |  |                           | |          
search RasMol script viewer Motif-ligand binding stats  betabulge ..    | |||     |   |    | || | |  | |   |       |  |  |   |        |  |                |  || |       |  |    | |                 |  || |    |  |          | |  |  || |     |   |   |  |       |   |||||      | || |       |        |   |            | |     |  | |  |    | |                   | |  ..betabulge..        |  |       |  | | ||| ||  |           |   | |           ||| |              | | **           |   | | |         |  | |         | ||||    | ||   |       |  |  | |     |   |          |  |                      | |   | ||||  |   |                           || || ||| |||     | |  | ||                               | | || |           ..betabulge..          |   | ||||          | |||| |  |     |  |||||||   |       |  |                           | |          
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..    *****     |   |    | || | |  | |   |       |  |  |   |        |  |                |  || |       |  |    | |                 |  || |    |  |          | |  |  || |     |   |   |  |       |   |||||      | || |       |        |   |            | |     |  | |  |    | |                   | |  ..betabulgeloop..        |  |       |  | | ||| ||  |           |   | |           ||| |              | |              |   | | |         |  | |         | ||||    | ||   |       |  |  | |     |   |          |  |                      | |   | ||||  |   |                           || || ||| |||     | |  | ||                               | | || |           ..betabulgeloop..          |   | ||||          | |||| |  |     |  |||||||   |       |  |                           | |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ****|     |   |    | **** |  | |   |       ****  |   |        ****                |  || |       |  |    | |                 |  || |    |  |          | |  ****| |     |   |   ****       |   |||||      | ****       |        |   |            | |     |  | |  |    | |                   | |  ..betaturn..        |  |       **** | ||| ||  |           |   | |           ||| |              | |              |   | | |         |  | |         | ||||    | ||   |       |  |  | |     |   |          |  |                      | |   ****||  |   |                           ****| |*****|     | |  | ||                               | | ****           ..betaturn..          |   | ||||          | |||| |  |     |  |****||   |       ****                           | |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      | |     |   |    | || | |  | |   |       |  |  |   |                            |  || |       |  |    | |                 |  || |    |  |          | |      | |     |   |              |   |||||      | || |       |        |   |            | |     |  | |  |    | |                   | |  ..gammaturn..        |  |       |  | | *** ||  |           |   | |           ||| |              | |              |   | | |         |  | |         | ||||    | ||   |       |  |  | |     |   |          |  |                      | |     | ||  |   |                            | || |   | |     | |  | ||                               | |  | |           ..gammaturn..          |   | ||||          | |||| |  |     |  |||| ||   |       |  |                           | |          
search RasMol script viewer Motif-ligand binding stats  nest ..      ***     |   |    | || | |  | |   |       |  |  |   |                            |  || |       |  |    ***                 |  || |    |  |          | |      | |     |   |              |   |****      | || |       |        |   |            ***     |  | |  |    ***                   ***  ..nest..        |  |       |  | |  |  ||  |           |   ***           *** |              ***              |   | ***         |  | |         | ****    | ||   |       |  |  ***     |   |          |  |                      ***     ***|  |   |                            | || |   ***     ***  | ||                               ***  | |           ..nest..          |   | ****          ***||| |  |     |  |||| ||   |       |  |                           ***          
search RasMol script viewer Motif-ligand binding stats  niche ..              |   |    ****** **** |   |       ****  |   |                            *******       ****                        |  ****    ****          ***      ***     |   |              |   |          ******       |        |   |                    **** ****                               ..niche..        ****       ******  ********           |   |              ****                               |   |             **** |         | |***    ****   |       ****          |   |          ****                                 ****   |                            ******                ****                                    ***           ..niche..          |   |  ***             |*******     ****|****|   |       ****                                        
search RasMol script viewer Motif-ligand binding stats  stmotif ..              |   |                |   |             |   |                                                                      |   |                                     |   |              |   |                       |        *****                                                            ..stmotif..                                              |   |                                                 |   |                | |         | | |     | |    |                     |   |                                                  *****                                                  | |                                                   ..stmotif..          |   |                  | |              **********                                                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                *****             *****                                                                      *****                                     *****              *****                       |                                                                         ..ststaple..                                              *****                                                 *****                | |         | | |     | |    |                     *****                                                                                                         | |                                                   ..ststaple..          *****                  | |              | |                                                          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                         |                                                                         ..stturn..                                                                                                                         ***         | | |     ***    |                                                                                                                                   ***                                                   ..stturn..                                 ***              ***                                                          
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                         *                                                                         ..REP00000..                                                                                                                                     * * *            *                                                                                                                                                                                         ..REP00000..                                                                                                               

   New search    3hnc:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors