triangle PDBeMotif: 3h60  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.3.16
Classification hydrolase    | release date: Thu, Apr 23, 2009
Title catalytic domain of human serine/threonine phosphatase 5 (pp5c)with two mn2+ atoms
Authors C.LUCHINAT, E.TALLURI, I.BERTINI, M.FRAGAI, V.CALDERONE
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search MN MN binding statistics MN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFE
LNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVF
EWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFL
EENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SERINE/THREONINE-PROTEIN PHOSPHATASE 5
member of: CATH:search3.60.21.10GENE3D:searchG3DSA_3.60.21.10PANTHER:searchPTHR11668/searchPTHR11668_SF12PFAM:searchPF00149/searchPF08321PIRSF:searchPIRSF033096PRINTS:searchSTPHPHTASEPROSITE PATTERNS:searchPS00125, SMART:searchSM00156SUPERFAMILY:searchSSF56300UniProt:searchP53041
JMol viewer RasMol script viewer  MN 501A  ..                                                                  * *                          *                                                                                                                                                                                                                           
JMol viewer RasMol script viewer  MN 500A  ..                                                                  | |                          |                               *                                                *                                                                                                                                          
sec str:  .............hhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh...eeee......eeeee.....hhhhhhhhhhhhh.......eeee........hhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeee...eeee..........hhhhhhhh.........hhhhhhhhhee.....eee......eeehhhhhhhhhhhhh..eeee........eeeehhh.eeee....hhhhh....eeeeeee..eeeeeeeee..............
sequence :  ..YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYA
seq num:  ..176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                     || |||                 |  |||| | ^**|^**      | |               | |||     | |||                 || ||  | |||| |     ||||       |   |      |  |       | |    |    |  ||  ||  | | |          |  |  | |     ^** |               | |      |  | |||     | |       |  | |||   |   |  | |                | ||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                     || |||                 |  ||^*** ^*** |       | |               | |||     | |||                 || ||  | |||| |     ||||       |   |      |  |       | |    |    |  |^***|  | | |          |  |  | |     | | |               | |      |  | |||     | |       |  | |||   |   |  | |                | ||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                     || |||                 |  || |     |  |       | |               | |||     | |||                 || ||  | ^*****     ||||       |   |      |  |       | |    ^*****  |    |  | | |          |  |  | |     | | |               | |      |  | |||     | |       |  | |^*****   |  | |                | ||
search RasMol script viewer Motif-ligand binding stats  SER_THR_PHOSPHATASE ..                     || |||                 |  || |     |  |       | |               | |||     | |||                 || ||  ****** |     ||||       |   |      |  |       | |         |  |    |  | | |          |  |  | |     | | |               | |      |  | |||     | |       |  | | |       |  | |                | ||
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     |****|                 ****| |     |  |       | |               ****|     | |||                 ****|     ||  |     ||||       |   |      |  |       | |         |  |    |  | | |          |  |  | |     | | |               | |      |  ****|     | |       **** | |       **** |                ****
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                     |  | |                 |  || |     |  |       | |               | | |     | |||                  |  |     ||  |     ||||       |   |      |  |       | |         |  |    |  | ***          |  |  | |     | | |               | |      |    | |     | |          | | |          | |                | | 
search RasMol script viewer Motif-ligand binding stats  nest ..                     |  ***                 |  || |     |  |       ***               | | |     ***||                  |  |     ||  |     ****       |   |      |  |       ***         |  |    |  |              |  |  | |     | ***               ***      |    ***     ***          *****          | |                *** 
search RasMol script viewer Motif-ligand binding stats  niche ..                     |    |                 *******     ****                         | | |        ||                  ****     ||  |                |   |      ****                   ****    ****              ****  ***     | |                          |                                        ***                    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                     ******                     | |                                  | | |        ||                           ||  |                |   |                                                                     | |                          |                                                               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                | |                                  *****        ||                           ||  |                *****                                                                     | |                          |                                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                ***                                  ***          ||                           ||  |                                                                                          ***                          |                                                               
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                  **                           **  *                                                                                            *                          *                                                               

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : SERINE/THREONINE-PROTEIN PHOSPHATASE 5
member of: CATH:search3.60.21.10GENE3D:searchG3DSA_3.60.21.10PANTHER:searchPTHR11668/searchPTHR11668_SF12PFAM:searchPF00149/searchPF08321PIRSF:searchPIRSF033096PRINTS:searchSTPHPHTASEPROSITE PATTERNS:searchPS00125, SMART:searchSM00156SUPERFAMILY:searchSSF56300UniProt:searchP53041
JMol viewer RasMol script viewer  MN 501B  ..                                                                  * *                          *                                                                                                                                                                                                                           
JMol viewer RasMol script viewer  MN 500B  ..                                                                  | |                          |                               *                                                *                                                                                                                                          
sec str:  .............hhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh...eeee......eeeee.....hhhhhhhhhhhhh.......eeee........hhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeee...eeee..........hhhhhhhh.........hhhhhhhhhee.....eee......eeehhhhhhhhhhhhh..eeee........eeeehhh.eeee....hhhhh....eeeeeee..eeeeeeeee..............
sequence :  ..YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYA
seq num:  ..176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                     || |||                 |  |||| | ^**|^**      | |                         | |||                  |  |  | |||| |     ||||       |   |      |  |       | |    |    |  ||  ||  | | |         ||  |  | |     ^** |               | |      |  | |||     | |       |  | |||   |   |  | |           | |  | ||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                     || |||                 |  ||^*** ^*** |       | |                         | |||                  |  |  | |||| |     ||||       |   |      |  |       | |    |    |  |^***|  | | |         ||  |  | |     | | |               | |      |  | |||     | |       |  | |||   |   |  | |           | |  | ||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                     || |||                 |  || |     |  |       | |                         | |||                  |  |  | ^*****     ||||       |   |      |  |       | |    ^*****  ||   |  | | |         ||  |  | |     | | |               | |      |  | |||     | |       |  | |^*****   |  | |           | |  | ||
search RasMol script viewer Motif-ligand binding stats  SER_THR_PHOSPHATASE ..                     || |||                 |  || |     |  |       | |                         | |||                  |  |  ****** |     ||||       |   |      |  |       | |         |  ||   |  | | |         ||  |  | |     | | |               | |      |  | |||     | |       |  | | |       |  | |           | |  | ||
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     |****|                 ****| |     ****       | |                         | |||                  |  |    **** |     ||||       |   |      |  |       | |         |  ||   **** | |         ||  |  | |     | | |               | |      |  ****|     | |       **** | |       **** |           | |  ****
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                     |  | |                 |  || |     |  |       | |                         | |||                  |  |     ||  |     ||||       |   |      |  |       | |         |  ||   |  | ***         ||  |  | |     | | |               | |      |    | |     | |          | | |          | |           ***  | | 
search RasMol script viewer Motif-ligand binding stats  nest ..                     |  ***                 |  || |     |  |       ***                         ***||                  |  |     ||  |     ****       |   |      |  |       ***         |  ||   |  |             ||  |  | |     | ***               ***      |    ***     ***          *****          | |                *** 
search RasMol script viewer Motif-ligand binding stats  niche ..                     |    |                 *******     ****                                      ||                  ****     ||  |                |   |      ****                   ****|   ****             |****  ***     | |                          |                                        ***                    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                     ******                     | |                                               ||                           ||  |                |   |                                 |   |                |   |          | |                          |                                                               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                | |                                               ||                           ||  |                *****                                 *****                |   |          | |                          |                                                               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                | |                                               ||                           ||  |                                                                           *****          | |                          |                                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                ***                                               ||                           ||  |                                                                                          ***                          |                                                               
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                  **                           **  *                                                                                            *                          *                                                               

   New search    3h60:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors