triangle PDBeMotif: 3h4b  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.7.7
Classification replication/dna    | release date: Sat, Apr 18, 2009
Title ternary complex of human dna polymerase iota with template u incoming datp
Authors A.K.AGGARWAL, D.T.NAIR, L.PRAKASH, R.E.JOHNSON, R.JAIN, S.PRAKASH
Method X-RAY DIFFRACTION (resolution: 2.85Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search DTP DTP binding statistics DTP
Modified residues:  search BRU BRU binding statistics BRU search DOC DOC binding statistics DOC
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
ASSRVIVHVDLDCFYAQVEMISNPELKDKPLGVQQKYLVVTCNYEARKLGVKKLMNVRDAKEKCPQLVLVNGEDLTRYRE
MSYKVTELLEEFSPVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLDVLHIRLLVGSQIAAEMR
EAMYNQLGLTGCAGVASNKLLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKEIPGIGYKTAKCLEALGINSVRDLQTF
SPKILEKELGISVAQRIQKLSFGEDNSPVILSGPPQSFSEEDSFKKCSSEVEAKNKIEELLASLLNRVCQDGRKPHTVRL
IIRRYSSEKHYGRESRQCPIPSHVIQKLGTGNYDVMTPMVDILMKLFRNMVNVKMPFHLTLLSVCFCNLK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DNA POLYMERASE IOTA
member of: CATH:search1.10.150.20/search3.30.1490.100/search3.30.70.270GENE3D:searchG3DSA_1.10.150.20/searchG3DSA_3.30.1490.100/searchG3DSA_3.30.70.270PANTHER:searchPTHR11076/searchPTHR11076_SF10PFAM:searchPF00817/searchPF11799PROSITE PROFILES:searchPS50173, SUPERFAMILY:searchSSF100879/searchSSF56672UniProt:searchQ9UNA4
JMol viewer RasMol script viewer  MG 871A  ..                                                                                                                                                                                                                                                                                                                                                          ..MG ..                ..           
JMol viewer RasMol script viewer  DTP 875A  ..            *                                 *     **                                                                                                                                       *                                                                                                                                                            ..DTP ..                ..           
sec str:  .......eeeeee.hhhhhhhhhhhhhhh...eeeee..eeeeehhhhhhh.....eehhhhhh.....eeee...hhhhhhhhhhhhhhhhhhh..eee....eeeeehhhhhhhhhhhh..hhhhh.....ee.hhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeee.hhhhhhhhhh......eee.hhhhhhhhhhh..hhhhh...hhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...............eeee.............hhhhhhhhhhhhhhhhhhh.eeeeeeeee...........ee..ee.hhhhhh... ..hhhhhhhhhhhhhhh.....eeeeeeeee
sequence :  ..ASSRVIVHVDLDCFYAQVEMISNPELKDKPLGVQQKYLVVTCNYEARKLGVKKLMNVRDAKEKCPQLVLVNGEDLTRYREMSYKVTELLEEFSPVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLDVLHIRLLVGSQIAAEMREAMYNQLGLTGCAGVASNKLLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKEIPGIGYKTAKCLEALGINSVRDLQTFSPKILEKELGISVAQRIQKLSFGEDNSPVILSGPPQSFSEEDSFKKCSSEVEAKNKIEELLASLLNRVCQDGRKPHTVRLIIRRYSSEKHYGRESRQCPIPSHVIQ... ..VMTPMVDILMKLFRNM..TLLSVCFCNLK
seq num:  ..25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365   ... ..379       389   ..404        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |                 ||||||                     | |            | |    ||||  |    ||| |      ||||   |  |           || ||| ||||||     |  ^***| ||||     || || |         |||   ||  | |                  |  |    |  | || ||  |   | | || ||| | ||| ||| |      |    |    |||||| |         |  |  ||||||| || |        || |||  |  |  | |   ||||| | |               ..PS00001..                ..           
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | |                 ||||||                     | |            | |    ||||  |    ||| |      ||||   |  |           || ||| ||||||     |  |   | ||||     || || |         |||   ||  | |                  |  |    |  | || ||  |   | | || ||| | ||| ||| |      |    |    |||||| |         |  |  ||**^*| || |        || |||  |  |  | |   **^*| | |               ..PS00004..                ..           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ^**                 ||||||                     | |            | |    ||||  |    ^** |      ||||   |  |           || ||| ||||||     |  |   | ||||     || || |         |||   ||  ^**                  |  |    |  | || ||  |   ^** || ||| ^**|| ||^**      |    |    |||||| |         |  |  ^**|  | || |        || |||  |  |  ^**    |  ^** |               ..PS00005..                ..           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                     ^***||                     | |            | |    ||||  |    ||  |      ||||   |  |           || ||| ||||||     |  |   | ||||     || || |         |||   ||    |                  |  |    |  | || ||  |       || ||| ^***| ||         |    |    |^***| |         ^***   | |  ^*** |        || |||  |  |         |      |               ..PS00006..                ..           
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                      || ||                     | |            | |    ||||  ******^  |      ||||   |  |           || ||| ||||||     |  |   | ||||     || || |         |||   ||    |                  |  |    |  | || ||  |       || ||| | | | ||         |    |    | |||| |                | |  | || |        || |||  |  |         *******^               ..PS00007..                ..           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                      || ||                     | |            | |    ||||       |   |      ||||   |  |           || ||| ||||||     |  |   | ||||     |^*****         |^*****^*****                  |  |    |  | || ||  |       || ||| | | | ||         ^*****    | |||| |                | |  | || |        || |||  |  |                                ..PS00008..                ..           
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                      || ||                     | |            | |    ||||       |   |      ||||   |  |           || ||| ||||||     |  |   | ||||     |  ||           | |                            |  |    |  | || ||  |       || ||| | | | ||                   | |||| |                | |  | || |        || |||  ^***                                ..PS00009..                ..           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                      || ||                     | |            | |    ||||       |   |      ||||   |  |           || ||| ||||||     |  |   | ||||     *****           | |                            |  |    |  | || ||  |       || ||| | | | ||                   | |||| |                | |  | || |        ******                                      ..alphabetamotif..                ..           
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                      || ||                     | |            | |    ||||       |   |      ||||   |  |           || ||| ||||||     |  |   *****|     |  |            | |                            |  |    |  | || ||  |       || ||| | | | ||                   | |||| |                | |  | || |        || ||                                       ..asxmotif..                ..           
search RasMol script viewer Motif-ligand binding stats  asxturn ..                      || ||                     | |            | |    ***|       |   |      ||||   |  |           || ||| ||||||     |  |   ******     |  |            | |                            |  |    |  | || ||  |       || ||| | | | ||                   | |||| |                | |  | || |        || ||                                       ..asxturn..                ..           
search RasMol script viewer Motif-ligand binding stats  betaturn ..                      *****                     | |            | |     | |       |   |      ||||   |  |           *****| *****|     ****   ****       ****            | |                            ****    |  | ********       *****| | | | ||                   ****|| |                | |  | || |        *****                                       ..betaturn..                ..           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       |  |                     | |            ***     | |       |   |      |***   |  |            |  |*** |  |            |  |                       | |                                    |  |  |  |  |       |  | | | | | ||                     | || |                ***  | || |                                                    ..gammaturn..                ..           
search RasMol script viewer Motif-ligand binding stats  nest ..                       |  |                     ***                    | |       |   |      | |    |  |            |  |    |  |            |  |                       ***                                    |  |  |  |  |       |  *** | | | ||                     ***| |                     ******                                                    ..nest..                ..           
search RasMol script viewer Motif-ligand binding stats  niche ..                       ****                                            ***       |   |      ***    ****            ****    ****            ****                                                              ****  *******       |    *** | ****                        ***                                                                               ..niche..                ..           
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                 |   |                                                                                                                                           ****** | | | |                                                                                                           ..schellmannloop..                ..           
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                 |   |                                                                                                                                                  ***** |                                                                                                           ..stmotif..                ..           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                 *****                                                                                                                                                    *****                                                                                                           ..ststaple..                ..           

chain P : 5'-D(*AP*GP*GP*AP*CP*CP*(DOC))-3'
JMol viewer RasMol script viewer  DTP 875A  ..      *
sec str:  .........
sequence :  ..AGGACCC
seq num:  ..867    

chain T : 5'-D(*TP*(BRU)P*GP*GP*GP*TP*CP*CP*T)-3'
JMol viewer RasMol script viewer  DTP 875A  .. *       
sec str:  ...........
sequence :  ..TUGGGTCCT
seq num:  ..839      

   New search    3h4b:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors