triangle PDBeMotif: 3h13  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification apoptosis    | release date: Fri, Apr 10, 2009
Title c-flipl protease-like domain
Authors J.W.YU, P.D.JEFFREY, Y.SHI
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
KEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHG
ISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLE
NSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNG
YMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CASP8 AND FADD-LIKE APOPTOSIS REGULATOR
member of: CATH:search3.40.50.1460GENE3D:searchG3DSA_1.10.533.10/searchG3DSA_3.40.50.1460PANTHER:searchPTHR10454PFAM:searchPF00656PROSITE PROFILES:searchPS50208, SMART:searchSM00115SUPERFAMILY:searchSSF52129UniProt:searchO15519
sec str:  ..............eeeeeee......hhhhhhhhhhheeeeeee..hhhhhhhhhhhhhhhhhhhhh.eeeeeeeeeee..ee.........eehhhhhhhh....hhhhh...eeeeeeeee.........eeeeeeeeehhhhhhhh...hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee..........
sequence :  ..PEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVS..HREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSY
seq num:  ..240       250       260       270       280       290       300       310       320       330       340       350       360 ..396       406       416       426       436       446       456       466       476 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |                | ||^***||  |   | |        |   |    | |  |  |  |          ||  || | | |||   |  ||| ||    | ||||            ..| || |       | |  | |  | |   |  | |   |  |                |  ||||||       | |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |                | |||| |||  |   | |        |   |    | |  |  |  |          ||  || | | |||   |  ||| ||    | ||||            ..| || |       | |  | |  | |   |  ^**   |  |                |  |^**||       ^**       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..**                | |||| |||  |   | |        |   |    | |  |  |  |          ||  || | | |||   |  ||| ||    | ||||            ..| || |       | ^*** |  | |   |        |  |                |  |^***|                 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                  | |||| |||  |   | |        |   |    ^*****  |  |          ^***** ^*****|   |  ||| ||    | ||||            ..| || |       | |    |  | |   |        |  |                |  ||| ||                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                  | |||| |||  |   | |        |   |      |  |  |  |          ||  |  | | | |   *****| ||    | ||||            ..| || |       | |    |  | |   |        |  |                |  ||| ||                 
search RasMol script viewer Motif-ligand binding stats  asxturn ..                  ***||| |||  |   | |        |   |      |  |  |  |          ||  |  | | | |   |  ||| ||    | ||||            ..| || |       ***    |  | |   |        |  |                |  ||| ||                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                    |||****|  |   | |        |   |      |  |  ****          ||  |  | | | |   ********|    ******            ..| || |              |  | |   |        |  |                |  |****|                 
search RasMol script viewer Motif-ligand binding stats  nest ..                    ********  |   ***        |   |      |  |  |  |          ||  |  | | | |        |  |    | ||||            ..| || |              |  | |   |        |  |                |  | |  |                 
search RasMol script viewer Motif-ligand binding stats  niche ..                          |   |              |   |      ****  ****          |****  *** | |        ****    ******            ..******              **** |   |        ****                **** ****                 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                          |   |              *****                          |          | |                    |             ..                         *****                                                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                          *****                                             |          | |                    |             ..                                                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                            |          ***                    |             ..                                                                                    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                            *                                 *             ..                                                                                    

   New search    3h13:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors