triangle PDBeMotif: 3gyq  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.1.1.66
Classification transferase    | release date: Sat, Apr 4, 2009
Title structure of the thiostrepton-resistance methyltransferase s-adenosyl-l-methionine complex
Authors G.L.CONN, M.S.DUNSTAN
Method X-RAY DIFFRACTION (resolution: 2.45Å)
PDBe Citation   
Small molecules:    search SAM SAM binding statistics SAM
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GSHMTELDTIANPSDPAVQRIIDVTKPSRSNIKTTLIEDVEPLMHSIAAGVEFIEVYGSDSSPFPSELLDLCGRQNIPVR
LIDSSIVNQLFKGERKAKTFGIARVPRPARFGDIASRRGDVVVLDGVKIVGNIGAIVRTSLALGASGIILVDSDITSIAD
RRLQRASRGYVFSLPVVLSGREEAIAFIRDSGMQLMTLKADGDISVKELGDNPDRLALLFGSEKGGPSDLFEEASSASVS
IPMMSQTESLNVSVSLGIALHERIDRNLAANR
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RRNA (ADENOSINE-2'-O-)-METHYLTRANSFERASE
member of: CATH:search3.30.1330.30/search3.40.1280.10GENE3D:searchG3DSA_3.40.1280.10PANTHER:searchPTHR12029PFAM:searchPF00588/searchPF04705PRODOM:searchPD407686SUPERFAMILY:searchSSF75217UniProt:searchP18644
JMol viewer RasMol script viewer  SAM 270B  ..                                                                                                                               *                                                                                                                                     
JMol viewer RasMol script viewer  SAM 270A  ..                                                                                                                               |                                                           ***                   *****              *** *     **    *                
sec str:  .........hhhhhhhhh.......eeee.hhhhhhhhhh...eeeeeeee.........hhhhhh....eeeehhhhhh..........eeeeee.....hhhhhhhh...eeeee...hhhhhhhhhhhhhhh...eeeee........hhhhhhhhhhhhhh..eeeehhhhhhhhhhh...eeeee.....ee.hhhhhh...eeeeee......hhhhh....eeee..........hhhhhhhhhhhhhhhhhh...
sequence :  ..ANPSDPAVQRIIDVTKPSRSNIKTTLIEDVEPLMHSIAAGVEFIEVYGSDSSPFPSELLDLCGRQNIPVRLIDSSIVNQLFKGERKAKTFGIARVPRPARFGDIASRRGDVVVLDGVKIVGNIGAIVRTSLALGASGIILVDSDITSIADRRLQRASRGYVFSLPVVLSGREEAIAFIRDSGMQLMTLKADGDISVKELGDNPDRLALLFGSEKGGPSDLFEEASSASVSIPMMSQTESLNVSVSLGIALHERIDRNLAAN
seq num:  ..8         18        28        38        48        58        68        78        88        98        108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |   | |   |  |       |  |   |   |             | |            | |     |  |||  |     | |            | | ||| |   |  | | |    |      | |      |||| | || |||  |||||  |    | ||        | |   | |  | || |||  | |      |||| | | |||  |         |  |  ^***     |  |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |   | |   |  |       |  |   |   |             | |            | |     |  |||  |     | |            | | ^** |   |  | | |    |      | |      |||| | || |||  |||||  |    ^**|        | |   ^**  | |^**||  | |      |^** | | |||  |         |  |           |  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |   | |   |  |       ^***   |   |             | |            | |     |  |||  |     | |            | | ||| |   |  | | |    |      | |      |||| ^*** |||  |||||  |    ^***        | |     |  | |^***|  | |      | |  | | |||  |         ^***           |  |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |   | |   |  |              |   |             | |            | |     |  |||  |     | |            | | ||| |   |  | | ^*****      | |      |||| | || |||  |||||  |                | |     |  | || | |  | |      ^***** | |||  |                        |  |        
search RasMol script viewer Motif-ligand binding stats  RGD .. | |   | |   |  |              |   |             | |            | |     |  |||  |     | |            | | ||***   |  | |             | |      |||| | || |||  |||||  |                | |     |  | || | |  | |      | |  | | |||  |                        |  |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |   | |   |  |              |   |             | |            | |     *****|  |     | |            | | ||      |  | |             | |      |||| | || ||*****|||  |                | |     |  | || | |  | |      | |  | | |||  |                        |  |        
search RasMol script viewer Motif-ligand binding stats  asxturn .. | |   | |   |  |              |   |             | |            | |     |  | |  |     | |            | | ||      |  | |             | |      |||| | |***||  | |||  |                | |     |  | || | |  ***      | |  | | |||  |                        |  |        
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |   | |   |  |              |   |             | |            | |     **** |  |     | |            | | ||      |  | |             | |      |||| | |   |*******|  |                | |     |  | || | |  | |      | |  | ****|  |                        ****        
search RasMol script viewer Motif-ligand binding stats  gammaturn .. | |   | |   |  |              |   |             ***            | |          |  |     ***            | | ||      |  | |             | |      |||| | |   |   | | |  |                | |     |  | || | |  | |      | |  | | | |  |                                    
search RasMol script viewer Motif-ligand binding stats  nest .. | |   ***   |  |              |   |                            ***          |  |                    | | ||      |  | |             ***      **** | |   |   *****  |                ***     |  | || | |  | |      | |  | | | |  |                                    
search RasMol script viewer Motif-ligand binding stats  niche .. ***         ****              |   |                                         ****                    | ****      ******                       | | | |   |   |   ****                        ******| | ******      ****** | | ****                                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                               |   |                                                                 |   |                                    | | | |   |   |                                     | |                    *****                                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                               *****                                                                 *****                                    | | | |   *****                                     | |                    | |                                         
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                              *** ***                                             ***                    ***                                         

chain B : RRNA (ADENOSINE-2'-O-)-METHYLTRANSFERASE
member of: CATH:search3.30.1330.30/search3.40.1280.10GENE3D:searchG3DSA_3.40.1280.10PANTHER:searchPTHR12029PFAM:searchPF00588/searchPF04705PRODOM:searchPD407686SUPERFAMILY:searchSSF75217UniProt:searchP18644
JMol viewer RasMol script viewer  SAM 270B  ..                                                                                                                                                                                           ***                    ****              *** *     ** *  *                
JMol viewer RasMol script viewer  SAM 270A  ..                                                                                                                               *                             *                             |||                    ||||              ||| |     || |  |                
sec str:  .........hhhhhhhhh.......eeeeehhhhhhhhhhh...eeeeeee.......hhhhhhhhh...eeeehhhhhhhh........eeeeee.....hhhhhhh....eeeee...hhhhhhhhhhhhhhh...eeeee........hhhhhhhh........eeeehhhhhhhhhhhh..eeeee.....ee.hhhhhh...eeeee.......hhhhhhh..eeee..........hhhhhhhhhhhhhhhhhhhh.
sequence :  ..ANPSDPAVQRIIDVTKPSRSNIKTTLIEDVEPLMHSIAAGVEFIEVYGSDSSPFPSELLDLCGRQNIPVRLIDSSIVNQLFKGERKAKTFGIARVPRPARFGDIASRRGDVVVLDGVKIVGNIGAIVRTSLALGASGIILVDSDITSIADRRLQRASRGYVFSLPVVLSGREEAIAFIRDSGMQLMTLKADGDISVKELGDNPDRLALLFGSEKGGPSDLFEEASSASVSIPMMSQTESLNVSVSLGIALHERIDRNLAAN
seq num:  ..8         18        28        38        48        58        68        78        88        98        108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          |  ||   | |   |  |   |   || |||       |  |            | |         |  |   | || |           || ||||| |   |  | | |    |      | |      |||| | ||  ||  | ||| ||    | ||        | |   | |  | || |||  | |      |||| | |||||  |         |  |  ^***|                
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          |  ||   | |   |  |   |   || |||       |  |            | |         |  |   | || |           || ||^** |   |  | | |    |      | |      |||| | ||  ||  | ||| ||    ^**|        | |   ^**  | |^**||  | |      |^** | |||||  |         |  |  | | |                
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  ||   | |   ^***   |   || |||       |  |            | |         |  |   | || |           || ||||| |   |  | | |    |      | |      |||| ^***  ||  | ||| ||    ^***        | |     |  | |^***|  | |      | |  | |||||  |         ^***  | | |                
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          |  ||   | |          |   || |||       |  |            | |         |  |   | || |           || ||||| |   |  | | ^*****      | |      |||| | ||  ||  | ||| ||                | |     |  | || | |  | |      ^***** |||||  |               | | |                
search RasMol script viewer Motif-ligand binding stats  RGD ..          |  ||   | |          |   || |||       |  |            | |         |  |   | || |           || ||||***   |  | |             | |      |||| | ||  ||  | ||| ||                | |     |  | || | |  | |        |  | |||||  |               | | |                
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          *****   | |          |   || |||       |  |            | |         |  |   | || |           *****||      |  | |             | |      |||| | |*****  | ||| ||                | |     |  | || | |  | |        |  | |||||  |               | | |                
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  |    | |          |   || |||       |  |            | |         |  |   | || |           || | ||      |  | |             | |      |||| | ||  |   | ||| ||                | |     |  | || | |  ***        |  | |||||  |               *** |                
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ****    | |          |   |****|       |  |            | |         |  |   | || |           **** ||      |  | |             | |      |||| | |****   | |****|                | |     |  | || | |  | |        **** *****  |               |   |                
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                  | |          |   |  | |       |  |            | |         |  |   ***| |            | | ||      |  | |             | |      |||| | ||      | | |  |                | |     |  | || | |  | |        |  | | | |  |               |   |                
search RasMol script viewer Motif-ligand binding stats  nest ..                  | |          |   |  ***       |  |            ***         |  |      ***            | | ||      |  | |             ***      **** | ||      *****  |                ***     |  | || | |  | |        |  | | | |  |               |   |                
search RasMol script viewer Motif-ligand binding stats  niche ..                  ***          |   |            ****                        ****                     | ****      ******                       | | ****          ****                        ******| | ******        **** | | ****               |   |                
search RasMol script viewer Motif-ligand binding stats  stmotif ..                               |   |                                                                 |   |                                    | | | |                                             | |                    *****                  |   |                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                               *****                                                                 *****                                    | | | |                                             | |                    | |                    *****                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                              *** ***                                             ***                    ***                                         

   New search    3gyq:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors