triangle PDBeMotif: 3gni  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein/signaling protein    | release date: Tue, Mar 17, 2009
Title structure of strad and mo25
Authors D.M.F.VAN AALTEN, D.R.ALESSI, E.ZEQIRAJ, S.GOLDIE
Method X-RAY DIFFRACTION (resolution: 2.35Å)
PDBe Citation   
Small molecules:    search ATP ATP binding statistics ATP   search CIT CIT binding statistics CIT
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQLAQELYNSGLL
STLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKII
LWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDR
HNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFN
DEKTYLVKQIRDLKRPAQQEA
Chain B sequence:
MAHHHHHHMENLYFQGMSSFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVS
KLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHIL
ISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDM
PATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQR
NPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGLVTNLEELEVDDWEF
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN MO25
member of: CATH:search1.25.10.10GENE3D:searchG3DSA_1.25.10.10PANTHER:searchPTHR10182/searchPTHR10182_SF11PFAM:searchPF08569SUPERFAMILY:searchSSF48371UniProt:searchQ9Y376
JMol viewer RasMol script viewer  CIT 342A  ..                                                                                                         *                                            *                                         *                                                                                                                                              
sec str:  ...........hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh.hhhhhhhhhh.hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhh....
sequence :  ..PFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |  | ||  ||         |  |   | | |                    |  |            |   ||||  |  || ||  |  |        |  |  | |                   |  |             |  |      |  |        |  ||| |       | ||  |                  |  | |  | | |||||| |    |  | |^*** | | || |      || || |             |  | ^***                |  || ||| ||  |   |     |  |   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | |  | ||  ||         |  |   | | |                    |  |            |   ||||  |  || ||  |  |        |  |  | |                   |  |             |  |      |  |        |  ||| |       | ||  |                  |  | |  | | ||**^* |    |  | |||   | | || |      || || |             |  |                     |  || ||| ||  |   |     |  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |  ^**|  ||         |  |   ^** |                    |  |            |   ||||  |  || ||  |  |        |  |  | |                   |  |             |  |      |  |        |  ||| |       ^**|  |                  |  | |  | | |^** ^**    |  | |||   | | || |      || || |             |  |                     |  || ||| ||  |   |     |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |     ^***|         |  |   |   |                    |  |            |   ||||  |  || ||  |  |        |  |  | |                   |  |             |  |      |  |        |  |^***       ^***  |                  ^*** |  | | ||   |      |  | |||   | | ^***      || || |             |  |                     |  || ||^***  |   |     |  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |     |   |         |  |   |   |                    |  |            |   |^*****  || ||  |  |        |  |  | |                   |  |             |  |      |  |        |  | |           |   |                       |  | | ||   |      |  | |||   | |  |        || || |             |  |                     |  || ||  |   |   |     |  |   
search RasMol script viewer Motif-ligand binding stats  AMIDATION .. | |     |   |         |  |   |   |                    |  |            |   ||||     || ||  ^***        |  |  | |                   |  |             |  |      |  |        |  | |           |   |                       |  | | ||   |      |  | |||   | |  |        || || |             |  |                     |  || ||  |   |   |     |  |   
search RasMol script viewer Motif-ligand binding stats  asxmotif .. | |     |   |         |  |   |   |                    |  |            |   ||||     || ||              |  |  | |                   |  |             |  |      |  |        |  | |           |   |                       |  | | ||   |      |  *****   | |  |        || || |             |  |                     |  || ||  |   |   |     |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn .. | |     |   |         |  |   |   |                    |  |            |   ||||     || ||              |  |  | |                   |  |             |  |      |  |        |  | |           |   |                       |  | ***|   |      |  ***||   | |  |        || |***             |  |                     |  || ||  |   |   |     |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |     |   |         |  |   |   |                    |  |            |   ||||     ****|              |  |  | |                   |  |             |  |      |  |        |  | |           |   |                       |  | |  |   |      |  ****|   | |  |        ****| |             |  |                     |  || ||  |   |   |     |  |   
search RasMol script viewer Motif-ligand binding stats  gammaturn .. ***     |   |         |  |   |   |                    |  |            |   ||||      |  |              |  |  | |                   |  |             |  |      |  |        |  | |           |   |                       |  | |  |   |      |  |   |   | |  |         |  | |             |  |                     |  || ||  |   |   |     |  |   
search RasMol script viewer Motif-ligand binding stats  nest ..         |   |         |  |   |   |                    |  |            |   ****      |  |              |  |  | |                   |  |             |  |      |  |        |  | |           |   |                       |  | |  |   |      |  |   |   | |  |         |  | |             |  |                     |  |***|  |   |   |     |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..         |   |         ****   |   |                    ****            |   |         ****              ****  ***                   ****             ****      ****        ******           |   |                       ******  |   |      ****   |   | ****         ******             ****                     ***********   |   |     ****   
search RasMol script viewer Motif-ligand binding stats  stmotif ..         *****                *****                                    |   |                                                                                                               |   |                          | |  |   |             |   |                                                                        |   |            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                       *****                                                                                                               *****                          | |  *****             *****                                                                        *****            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                          ***                                                                                                                  

chain B : STRAD ALPHA
member of: GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24361/searchPTHR24361_SF248PFAM:searchPF00069PROSITE PROFILES:searchPS50011, SUPERFAMILY:searchSSF56112UniProt:searchQ7RTN6
JMol viewer RasMol script viewer  CIT 342A  ..              ..                                                                                                                                                                   *                                                                    ..CIT ..                                   ..                ..       
JMol viewer RasMol script viewer  ATP 1B  ..              ..               *****   * *            * *                                              ** *      *                                         ** *            *       |                                                                    ..ATP ..                                   ..                ..       
sec str:  .......hhhhhh..........hhh.eeeeeeeeee....eeeeeeee.....eeeeeeee.hhhhhhhhhhhhhhhhhhhhh.......eeeeeee..eeeeeee.....hhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee.hhhhhee.ee..ee.............hhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh..........hhhhhh... ...hhhhhhhhhhhh........hhhhhhhhhhhhhh.....hhhhhh................
sequence :  ..AHHHHHHMENLYFQ..SSFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDMPATQMLLEK... ..FSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQI..ASEALPELLRPVTPIT..EVDDWEF
seq num:  ..-15       -5  ..60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280         ... ..348       358       368       378  ..386       396   ..425    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       |  |   ..      |  |        || |||      |  | |  | |  ||| ||   |         |  | |  |   ||   |  |       |  || |||    |  |           |    |     | | | | || ||  | |||    ||| ^***||  |  | | |   |||| |  |            | ||   | | |  |  | || || |         ..PS00001..          |  |  |  |     | ^*** |  ..||    |  | |   |..       
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..       |  |   ..      |  |        || |||      |  | |  | |  ||| ||   |         |  | |  |   ||   |  |       |  || |||    |  |           |    |     | | | | || ||  | |||    ||| ||| ||  |  | | |   |||| |  |            | ||   | | |  |  | || || |         ..PS00004..          |  |  |  |     |  ||  |  ..^*    |  | |   |..       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       |  |   ..      |  |        || |||      |  | |  ^**  ||| ||   |         |  | |  |   ||   |  |       |  |^**||    |  |           |    |     | | | ^**| ||  | |||    ||| ||| ||  |  | | |   |^** |  |            | ||   | | |  |  | || || |         ..PS00005..          |  |  |  |     |  ||  |  ..      |  | |   |..       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       |  |   ..      |  |        || |||      |  | |       ||| ||   |         |  | |  |   ||   |  |       |  |^***|    |  |           |    |     | | | | || ||  | |||    ||| ||| ||  |  | | |   | || |  |            | ||   | | ^***  | || || |         ..PS00006..          |  |  |  |     |  ||  |  ..      |  | |   ^..       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..       |  |   ..      |  |        || |||      |  | |       ||| ||   |         |  | |  |   ||   |  |       |  ||   |    |  |           |    |     | | | | || ||  | |||    ||| ||| ||  |  ********^ || |  |            | ||   | | |  |  | || || |         ..PS00007..          |  |  |  |     |  ||  |  ..      |  | |    ..       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       |  |   ..      |  |        || |||      |  | |       ||| ||   |         |  | |  |   ||   |  |       |  ||   |    |  |           ^*****     | | | | || ||  | |||    ^*****| ||  |    | |   | || |  |            | ||   | ^*****  | || || |         ..PS00008..          |  |  |  |     |  ||  |  ..      |  | |    ..       
search RasMol script viewer Motif-ligand binding stats  asxturn ..       |  |   ..      |  |        || |||      |  | |       *** ||   |         |  | |  |   ||   |  |       |  ||   |    |  |                      | | | | || ||  | |||    ||| | | ||  |    | |   | || |  |            ***|   |   |     | || || |         ..asxturn..          |  |  |  |     |  ||  |  ..      |  | |    ..       
search RasMol script viewer Motif-ligand binding stats  betabulge ..       |  |   ..      |  |        || |||      |  | |        |  ||   |         |  | |  |   **   |  |       |  ||   |    |  |                      | | | | || ||  | |||    ||| | | ||  |    | |   | || |  |               |   |   |     | || || |         ..betabulge..          |  |  |  |     |  ||  |  ..      |  | |    ..       
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..       |  |   ..      |  |        ******      ******        |  ||   |         |  | |  |        |  |       |  ||   |    |  |                      | | | | || ||  *****    ||| | | ||  |    | |   | || |  |               |   |   |     | || || |         ..betabulgeloop..          |  |  |  |     |  ||  |  ..      |  | |    ..       
search RasMol script viewer Motif-ligand binding stats  betaturn ..       |  |   ..      |  |         ****|         | |        ****|   |         |  | ****        |  |       ****|   |    ****                      | | | | || ||  ****|    ||| | | |****    | |   | || ****               |   |   |     | || || |         ..betaturn..          |  |  |  |     |  |****  ..      |  | |    ..       
search RasMol script viewer Motif-ligand binding stats  nest ..       |  |   ..      |  |           ***         ***        |  ||   |         |  | |  |        |  |           |   |                              *** *** || ||    ***    *** | | |        | |   ******  |               |   |   |     ***| || |         ..nest..          |  |  |  |     |  |      ..      |  | |    ..       
search RasMol script viewer Motif-ligand binding stats  niche ..       ****   ..      ****           ***                    ****|   |         **** ****        ****           |   |                                    | |****            **** ***        ***   ***  ****               |   |   |        ******         ..niche..          ****  ****     ****      ..      ******    ..       
search RasMol script viewer Motif-ligand binding stats  stmotif ..              ..                                                *****                                         *****                                    | |  |                  | |                                      |   |   |                       ..stmotif..                                   ..                ..       
search RasMol script viewer Motif-ligand binding stats  ststaple ..              ..                                                                                                                                       | |  |                  | |                                      *********                       ..ststaple..                                   ..                ..       
search RasMol script viewer Motif-ligand binding stats  stturn ..              ..                                                                                                                                       | |  |                  ***                                                                      ..stturn..                                   ..                ..       
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..              ..                                                                                                                                       * *  *                                                                                           ..REP00000..                                   ..                ..       

   New search    3gni:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors