triangle PDBeMotif: 3gjn  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.
Classification hydrolase    | release date: Mon, Mar 9, 2009
Title following evolutionary paths to high affinity and selectivit protein interactions using colicin7 and immunity proteins
Authors D.S.TAWFIK, O.DYM
Method X-RAY DIFFRACTION (resolution: 2.48Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,D sequence:
MELKHSISDYTEAEFLQLVTTICDAEATSEEELDKLITHFEEMTEHPSGSDLIYWPKEGDDDSPSGIVNTVKQWRAANGK
SGFKQG
Chains B,C sequence:
MHHHHHHSMGKRNKPGKATGKGKPVNNKWLNNAGKDLGSPVPDRIANKLRDKEFKSFDDFRKKFWEEVSKDPELSKQFSR
NNNDRMKVGKAPKTRTQDVSGKRTSFELHAEKPISQNGGVYDMDNISVVTPKRHIDIHRGK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : COLICIN-E9 IMMUNITY PROTEIN
member of: CATH:search1.10.1200.20GENE3D:searchG3DSA_1.10.1200.20PFAM:searchPF01320PRINTS:searchPYOCINPRODOM:searchPD007225SUPERFAMILY:searchSSF47345UniProt:searchP13479
sec str:  ....hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh....hhhhhh.......hhhhhhhhhhhhhhhh.......
sequence :  ..KHSISDYTEAEFLQLVTTICDAEATSEEELDKLITHFEEMTEHPSGSDLIYWPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
seq num:  ..1004      1014      1024      1034      1044      1054      1064      1074        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  || |||  ||     |  | | |  |  |   ||||||| | | || ||  |  || || ||| ^**     | |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ^***|^***|     ^*** | ^***  |   ^***||| | ^*** ||  |  || || ||| ||      | |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  ||   |          | |     |   ||| ||| | | || ||  |  || || ^*****      | |     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  ||   |          | |     |   |*****| | | *****  |  || |***** |       | |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****|   |          | |     |   |**** | | ******   ****| |****  |       | |     
search RasMol script viewer Motif-ligand binding stats  nest ..   |  ||   |          ***     |   | |   ***          |  || |  ||  |       ***     
search RasMol script viewer Motif-ligand binding stats  niche ..   ****|   |                  |   | |   | |          *******  ||  |               
search RasMol script viewer Motif-ligand binding stats  stmotif ..       *****                  |   | |   | |                *****  |               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                              ***** ***** |                   *****               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                        ***                                       

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : COLICIN-E7
member of: CATH:search3.90.540.10GENE3D:searchG3DSA_1.10.287.620/searchG3DSA_3.90.540.10PFAM:searchPF11570/searchPF12639SMART:searchSM00507SUPERFAMILY:searchSSF54060/searchSSF69985UniProt:searchQ47112
JMol viewer RasMol script viewer  ZN 600B  ..                                                                                            *    ..              *   *   
sec str:  ...ee........hhhhhh.....ee.hhhhhhhhh.....hhhhhhhhhhhhhh.hhhhhh..hhhhhhhhhh......hhhhh.......eeee......ee...eeeehhhhhhhhhh..
sequence :  ..KATGKGKPVNNKWLNNAGKDLGSPVPDRIANKLRDKEFKSFDDFRKKFWEEVSKDPELSKQFSRNNNDRMKVGKAPKTRTQDVSGKRTSFELHAEKP..VYDMDNISVVTPKRHIDIHRGK
seq num:  ..452       462       472       482       492       502       512       522       532       542    ..555       565         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  | |          |  |  |                 |  |        |  | ||| |||   |  | |||     |  || |||| | ||   ..  |||^*** | |      | |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  | |          |  |  |                 |  |        |  | ||| |||   |  | |||     |  || **^* | ||   ..  ||| |   | |      | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  ^**          |  |  |                 |  |        |  | ||| |||   |  | |||     |  |^**||| | ||   ..  ||| |   ^**      | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..               |  |  |                 ^***        |  | ||| |||   |  | |||     |  ||  |^*** ||   ..  ||| |            | |
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..               |  |  |                             |  | ||| |||   |  | |||     |  |^*** | | ||   ..  ||| |            | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..               |  |  |                             |  ***** |||   |  | |||     |  |   | | | ||   ..  ||| |            | |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..               |  |  |                             |  ***** |||   |  | |||     |  |   | | | ||   ..  ||| |            | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..               |  |  |                             |  ***|| |||   |  | |||     |  |   | | | ||   ..  *** |            | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..               |  ****                             |  *******||   |  ****|     |  |   | | | ||   ..   |  |            | |
search RasMol script viewer Motif-ligand binding stats  nest ..               |  |                                |  |   |  ||   |    ***     |  |   | | | ||   ..   |  |            ***
search RasMol script viewer Motif-ligand binding stats  niche ..               ****                                ****   ****|   |            ****   *** | ||   ..   ****               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                              *****                       | ||   ..                      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                          * **   ..                      

chain D : COLICIN-E9 IMMUNITY PROTEIN
member of: CATH:search1.10.1200.20GENE3D:searchG3DSA_1.10.1200.20PFAM:searchPF01320PRINTS:searchPYOCINPRODOM:searchPD007225SUPERFAMILY:searchSSF47345UniProt:searchP13479
sec str:  ....hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh....hhhhhh.......hhhhhhhhhhhhhhhh.......
sequence :  ..KHSISDYTEAEFLQLVTTICDAEATSEEELDKLITHFEEMTEHPSGSDLIYWPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
seq num:  ..1004      1014      1024      1034      1044      1054      1064      1074        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  ||||||  ||     |  | | |  |  |   | ||  | | |||| ||  |  || |  ||  ^**  |  | |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ^***|^***|     ^*** | ^***  |   ^***  | | ^*** ||  |  || |  ||  ||   |  | |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ||||||   |     |  | | |     |   | |   | | |||| ||  |  || |  ^*****   |  | |     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  ||||||   |     |  | | |     |   | |   | | ||*****  |  || *****  |    |  | |     
search RasMol script viewer Motif-ligand binding stats  asxturn ..  ||||||   |     |  | | |     |   | |   | | |||| |   |  |***  ||  |    |  | |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..  *****|   |     **** | |     |   | |   | ********   ****| ****|  |    **** |     
search RasMol script viewer Motif-ligand binding stats  nest ..  ||| ||   |     |  | ***     |   | |   ***          |  || |  ||  |       ***     
search RasMol script viewer Motif-ligand binding stats  niche ..  |****|   |     ****         |   | |   |            *******  ||  |               
search RasMol script viewer Motif-ligand binding stats  stmotif ..  **********                  |   | |   |                  *****  |               
search RasMol script viewer Motif-ligand binding stats  ststaple ..  | |                         ***** *****                     *****               
search RasMol script viewer Motif-ligand binding stats  stturn ..  ***                                                                             

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : COLICIN-E7
member of: CATH:search3.90.540.10GENE3D:searchG3DSA_1.10.287.620/searchG3DSA_3.90.540.10PFAM:searchPF11570/searchPF12639SMART:searchSM00507SUPERFAMILY:searchSSF54060/searchSSF69985UniProt:searchQ47112
JMol viewer RasMol script viewer  ZN 600C  ..                                                                                              *   ..              *   *   
sec str:  .....ee........hhhhhhhh...ee.hhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh......hhhhh.......eeee.....ee...eeeehhhhhhhhhh..
sequence :  ..PGKATGKGKPVNNKWLNNAGKDLGSPVPDRIANKLRDKEFKSFDDFRKKFWEEVSKDPELSKQFSRNNNDRMKVGKAPKTRTQDVSGKRTSFELHAEK..VYDMDNISVVTPKRHIDIHRGK
seq num:  ..450       460       470       480       490       500       510       520       530       540     ..555       565         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    | |          |  |  |       |  |      |  |  |  || || | |||  ||  || || |||     |  || |||| | ||  ..  |||^*** | | |    | |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    | |          |  |  |       |  |      |  |  |  || || | |||  ||  || || |||     |  || **^* | ||  ..  |||||   | | |    | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    ^**          |  |  |       |  |      |  |  |  || || | |||  ||  || || |||     |  |^**||  | ||  ..  |||||   ^** |    | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                 |  |  |       |  |      ^***  |  || || | |||  ||  || || |||     |  ||  |^*** ||  ..  |||||   |   |    | |
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                 |  |  |       |  |            |  || || | |||  ||  || || |||     |  |^***   | ||  ..  |||||   |   |    | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 |  |  |       |  |            ******** | |||  ||  || || |||     |  |       | ||  ..  |||||   |   |    | |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                 |  |  |       |  |            |  |  |  *****  ||  || || |||     |  |       | ||  ..  *****   |   |    | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..                 |  |  |       |  |            |  |  |  ***||  ||  || || |||     |  |       | ||  ..  ***||   |   |    | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 |  ****       ****            *******  ****|  ||  ********|     |  |       | ||  ..  ****|   |   |    | |
search RasMol script viewer Motif-ligand binding stats  nest ..                 |  |                                |  |   |  ||   |    ***     |  |       | ||  ..   |  |   |   |    ***
search RasMol script viewer Motif-ligand binding stats  niche ..                 ****                                ****   ****|   |            ****       | ||  ..   ****   |   |       
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                *****                       | ||  ..          *****       
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                            * **  ..                      

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : COLICIN-E9 IMMUNITY PROTEIN
member of: CATH:search1.10.1200.20GENE3D:searchG3DSA_1.10.1200.20PFAM:searchPF01320PRINTS:searchPYOCINPRODOM:searchPD007225SUPERFAMILY:searchSSF47345UniProt:searchP13479
sec str:  ....hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh....hhhhhh.......hhhhhhhhhhhhhhhh.......
sequence :  ..KHSISDYTEAEFLQLVTTICDAEATSEEELDKLITHFEEMTEHPSGSDLIYWPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
seq num:  ..1004      1014      1024      1034      1044      1054      1064      1074        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  ||||||  ||     |  | | |  |  |   | ||  | | |||| ||  |  || |  ||  ^**  |  | |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ^***|^***|     ^*** | ^***  |   ^***  | | ^*** ||  |  || |  ||  ||   |  | |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ||||||   |     |  | | |     |   | |   | | |||| ||  |  || |  ^*****   |  | |     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  ||||||   |     |  | | |     |   | |   | | ||*****  |  || *****  |    |  | |     
search RasMol script viewer Motif-ligand binding stats  asxturn ..  ||||||   |     |  | | |     |   | |   | | |||| |   |  |***  ||  |    |  | |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..  *****|   |     **** | |     |   | |   | ********   ****| ****|  |    **** |     
search RasMol script viewer Motif-ligand binding stats  nest ..  ||| ||   |     |  | ***     |   | |   ***          |  || |  ||  |       ***     
search RasMol script viewer Motif-ligand binding stats  niche ..  |****|   |     ****         |   | |   |            *******  ||  |               
search RasMol script viewer Motif-ligand binding stats  stmotif ..  **********                  |   | |   |                  *****  |               
search RasMol script viewer Motif-ligand binding stats  ststaple ..  | |                         ***** *****                     *****               
search RasMol script viewer Motif-ligand binding stats  stturn ..  ***                                                                             

   New search    3gjn:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors