triangle PDBeMotif: 3gge  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification protein binding    | release date: Fri, Feb 27, 2009
Title crystal structure of the pdz domain of pdz domain-containing gipc2
Authors A.C.W.PIKE, A.CHAIKUAD, A.K.R, A.M.EDWARDS, C.BOUNTRA, C.COOPER, C.H.ARROWSMITH, F.VON DELFT, J., J.ELKINS, P.FILIPPAKOPOULOS, STRUCTURAL GENOMICS CONSORTIUM (SGC), U.OPPERMANN, V.HOZJAN, W.YUE
Method X-RAY DIFFRACTION (resolution: 2.60Å)
PDBe Citation   
Small molecules:    search SO4 SO4 binding statistics SO4   search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C sequence:
SMKGIEKEVNVYKSEDSLGLTITDNGVGYAFIKRIKDGGVIDSVKTICVGDHIESINGENIVGWRHYDVAKKLKELKKEE
LFTMKLIEPKKSSEA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PDZ DOMAIN-CONTAINING PROTEIN GIPC2
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR12259/searchPTHR12259_SF3PFAM:searchPF00595PIRSF:searchPIRSF038083PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ8TF65
JMol viewer RasMol script viewer  SO4 2B  ..                                                                                               
sec str:  .....eeeeeeeee.......eeee.......eeeee...hhhhhh.......eeeee..ee....hhhhhhhhhhhh....eeeeeeeee...ee.
sequence :  ..SMKGIEKEVNVYKSEDSLGLTITDNGVGYAFIKRIKDGGVIDSVKTICVGDHIESINGENIVGWRHYDVAKKLKELKKEELFTMKLIEPKKSSEA
seq num:  ..-1        120       130       140       150       160       170       180       190       200  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| |              ||||  |||||  |    |  | | ||| ||  |    |  |||| |        |  ||  |  | |    **^*  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..^**              ||||  |||||  |    |  | | ^** ||  |    |  |||| |        |  ||  |  ^**          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                 |||^***||||  |    |  | |  |  ||  |    |  |||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                 |^*****|^*****    |  ^*****  ||  |    |  |||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  asxturn ..                 | |    ||||       |  | |  |  ||  |    |  |*** |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 | |    ||||       |  | |  ********    ****||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  nest ..                 ***    ****       |  | |  |  ||  |        ||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  niche ..                                   **** ***********        *****        ********               

chain B : PDZ DOMAIN-CONTAINING PROTEIN GIPC2
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR12259/searchPTHR12259_SF3PFAM:searchPF00595PIRSF:searchPIRSF038083PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ8TF65
JMol viewer RasMol script viewer  GOL 3B  ..                                                        * * *                               
JMol viewer RasMol script viewer  SO4 2B  ..                                                *       | | |                        **     
JMol viewer RasMol script viewer  SO4 1B  ..                                                |      *| | *       *                ||     
sec str:  ....eeeeeeee......eeee.......eeeee................eeeee..ee....hhhhhhhhhhhh...eeeeeeee.....eee
sequence :  ..GIEKEVNVYKSEDSLGLTITDNGVGYAFIKRIKDGGVIDSVKTICVGDHIESINGENIVGWRHYDVAKKLKELKKEELFTMKLIEPKKSSEA
seq num:  ..113       123       133       143       153       163       173       183       193         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..              ||||  |||||  | ||    | | ||| ||  |    |  |||| |        |  ||  |  | |    **^*  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..              ||||  |||||  | ||    | | ^** ||  |    |  |||| |        |  ||  |  ^**          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              |||^***||||  | ||    | |  |  ||  |    |  |||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              |^*****|^***** ||    ^*****  ||  |    |  |||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  asxturn ..              | |   ***||    ||      |  |  ||  |    |  |||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  betabulge ..              | |    ||||    **      |  |  ||  |    |  |||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |    ||||            |  |  |****    ****||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  nest ..              ***    ****            |  |  ||  |        ||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  niche ..                                     ***********        *****        ********               

chain C : PDZ DOMAIN-CONTAINING PROTEIN GIPC2
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR12259/searchPTHR12259_SF3PFAM:searchPF00595PIRSF:searchPIRSF038083PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ8TF65
JMol viewer RasMol script viewer  GOL 3B  ..* **                                                                                  *        
JMol viewer RasMol script viewer  SO4 1B  ..***|                                                                                  |        
sec str:  .....eeeeeeeee.......eeee.......eeeee...hhhhhh.......eeeee..ee....hhhhhhhhhhhh....eeeeeeeee......
sequence :  ..SMKGIEKEVNVYKSEDSLGLTITDNGVGYAFIKRIKDGGVIDSVKTICVGDHIESINGENIVGWRHYDVAKKLKELKKEELFTMKLIEPKKSSEA
seq num:  ..-1        120       130       140       150       160       170       180       190       200  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| |              ||||  |||||  | || |  | | ||| ||  |    |  |||| |        |  ||  |  | |    **^*  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..^**              ||||  |||||  | || |  | | ^** ||  |    |  |||| |        |  ||  |  ^**          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                 |||^***||||  | || |  | |  |  ||  |    |  |||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                 |^*****|^***** || |  ^*****  ||  |    |  |||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  asxturn ..                 | |   ***||    || |  | |  |  ||  |    |  |*** |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  betabulge ..                 | |    ||||    ** |  | |  |  ||  |    |  |||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 | |    ||||       |  | |  |  |****    ****||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  nest ..                 ***    ****       |  | |  |  ||  |        ||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  niche ..                                   **** ***********        *****        ********               

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PDZ DOMAIN-CONTAINING PROTEIN GIPC2
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR12259/searchPTHR12259_SF3PFAM:searchPF00595PIRSF:searchPIRSF038083PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ8TF65
JMol viewer RasMol script viewer  SO4 2B  ..                                                                                               
sec str:  .....eeeeeeeee.......eeee.......eeeee...hhhhhh.......eeeee..ee....hhhhhhhhhhhh....eeeeeeeee...ee.
sequence :  ..SMKGIEKEVNVYKSEDSLGLTITDNGVGYAFIKRIKDGGVIDSVKTICVGDHIESINGENIVGWRHYDVAKKLKELKKEELFTMKLIEPKKSSEA
seq num:  ..-1        120       130       140       150       160       170       180       190       200  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| |              ||||  |||||  |    |  | | ||| ||  |    |  |||| |        |  ||  |  | |    **^*  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..^**              ||||  |||||  |    |  | | ^** ||  |    |  |||| |        |  ||  |  ^**          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                 |||^***||||  |    |  | |  |  ||  |    |  |||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                 |^*****|^*****    |  ^*****  ||  |    |  |||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  asxturn ..                 | |    ||||       |  | |  |  ||  |    |  |*** |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 | |    ||||       |  | |  ********    ****||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  nest ..                 ***    ****       |  | |  |  ||  |        ||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  niche ..                                   **** ***********        *****        ********               

chain B : PDZ DOMAIN-CONTAINING PROTEIN GIPC2
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR12259/searchPTHR12259_SF3PFAM:searchPF00595PIRSF:searchPIRSF038083PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ8TF65
JMol viewer RasMol script viewer  GOL 3B  ..                                                        * * *                               
JMol viewer RasMol script viewer  SO4 2B  ..                                                *       | | |                        **     
JMol viewer RasMol script viewer  SO4 1B  ..                                                |      *| | *      **                ||     
sec str:  ....eeeeeeee......eeee.......eeeee................eeeee..ee....hhhhhhhhhhhh...eeeeeeee.....eee
sequence :  ..GIEKEVNVYKSEDSLGLTITDNGVGYAFIKRIKDGGVIDSVKTICVGDHIESINGENIVGWRHYDVAKKLKELKKEELFTMKLIEPKKSSEA
seq num:  ..113       123       133       143       153       163       173       183       193         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..              ||||  |||||  | ||    | | ||| ||  |    |  |||| |        |  ||  |  | |    **^*  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..              ||||  |||||  | ||    | | ^** ||  |    |  |||| |        |  ||  |  ^**          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              |||^***||||  | ||    | |  |  ||  |    |  |||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              |^*****|^***** ||    ^*****  ||  |    |  |||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  asxturn ..              | |   ***||    ||      |  |  ||  |    |  |||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  betabulge ..              | |    ||||    **      |  |  ||  |    |  |||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |    ||||            |  |  |****    ****||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  nest ..              ***    ****            |  |  ||  |        ||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  niche ..                                     ***********        *****        ********               

chain C : PDZ DOMAIN-CONTAINING PROTEIN GIPC2
member of: CATH:search2.30.42.10GENE3D:searchG3DSA_2.30.42.10PANTHER:searchPTHR12259/searchPTHR12259_SF3PFAM:searchPF00595PIRSF:searchPIRSF038083PROSITE PROFILES:searchPS50106, SMART:searchSM00228SUPERFAMILY:searchSSF50156UniProt:searchQ8TF65
JMol viewer RasMol script viewer  GOL 3B  ..* **                                                                                  *        
JMol viewer RasMol script viewer  SO4 1B  ..***|                                                                                  |        
sec str:  .....eeeeeeeee.......eeee.......eeeee...hhhhhh.......eeeee..ee....hhhhhhhhhhhh....eeeeeeeee......
sequence :  ..SMKGIEKEVNVYKSEDSLGLTITDNGVGYAFIKRIKDGGVIDSVKTICVGDHIESINGENIVGWRHYDVAKKLKELKKEELFTMKLIEPKKSSEA
seq num:  ..-1        120       130       140       150       160       170       180       190       200  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| |              ||||  |||||  | || |  | | ||| ||  |    |  |||| |        |  ||  |  | |    **^*  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..^**              ||||  |||||  | || |  | | ^** ||  |    |  |||| |        |  ||  |  ^**          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                 |||^***||||  | || |  | |  |  ||  |    |  |||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                 |^*****|^***** || |  ^*****  ||  |    |  |||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  asxturn ..                 | |   ***||    || |  | |  |  ||  |    |  |*** |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  betabulge ..                 | |    ||||    ** |  | |  |  ||  |    |  |||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 | |    ||||       |  | |  |  |****    ****||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  nest ..                 ***    ****       |  | |  |  ||  |        ||| |        |  ||  |               
search RasMol script viewer Motif-ligand binding stats  niche ..                                   **** ***********        *****        ********               

   New search    3gge:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors