triangle PDBeMotif: 3g73  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transcription/dna    | release date: Mon, Feb 9, 2009
Title structure of the foxm1 dna binding
Authors A.PERRAKIS, D.R.LITTLER, R.G.HIBBERT, R.H.MEDEMA
Method X-RAY DIFFRACTION (resolution: 2.21Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GPGPSRPSASWQNSVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRE
TSANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELRRNMTIKTELP
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FORKHEAD BOX PROTEIN M1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF140PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00657/searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchQ08050
JMol viewer RasMol script viewer  MG 996A  ..                                                         *  *  *                          
sec str:  ..........hhhhhhhhhhhh....eehhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh..eeeee......eeeee...........
sequence :  ..SVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLD
seq num:  ..232       242       252       262       272       282       292       302       312       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| |||   |   |    |^***||||| ||| |  |  |  |    |  |  | ||^***|| |      | |      || |||||   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| |||   |   |    |  | |**^* ||| |  |  |  |    |  |  | || || || |      | |      || |||||   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| ^**   |   |    |  ^** | ^**|| |  |  |  |    |  |  ^**| || || |      | |      || |||||   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***|   |   |    |  | | | ^***| ^***  |  |    |  |     | |^*** |      | |      || |||||   
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_1 ..|  |**************  | | | |   |       |  |    |  |     | |  |  |      | |      || |||||   
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..|  |    |   |    |  | | | |   |       |  |    |  ******* |  |  |      | |      || |||||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |    |   |    |  | | | |   |       |  |    |  |       |  |  |      | |      *****|||   
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  |    |   |    |  | | | |   |       |  |    |  |       |  |  |      | |      || |***|   
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |    |   |    |  | | | |   |       ****    ****       |  |  |      | |      ****|| |   
search RasMol script viewer Motif-ligand binding stats  nest ..|  |    |   |    |  | *** |   |                          |  |  |      ***       |  |***   
search RasMol script viewer Motif-ligand binding stats  niche ..****    |   |    ****     |   |                          *******                ****      
search RasMol script viewer Motif-ligand binding stats  stmotif ..        *****             *****                                                           

chain B : FORKHEAD BOX PROTEIN M1
member of: GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF140PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00657/searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchQ08050
JMol viewer RasMol script viewer  MG 996B  ..                                                       *  *  *                                 
sec str:  ........hhhhhhhhhhhh....eehhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh..eeeee......eeeee.hhhh...hhhhhh....
sequence :  ..SERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPLD
seq num:  ..234       244       254       264       274       284       294       304       314       324  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|||   |   |    |^***||||| ||| |  |  |  ||  ||  |  | ||^***|| |    | ||||         |||| || ||    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|||   |   |    |  | |**^* ||| |  |  |  ||  ||  |  | || || || |    | ||||         |||| || ||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..^**   |   |    |  ^** | ^**|| |  |  |  ||  ||  |  ^**| || || |    | ||||         |||| || ||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..**|   |   |    |  | | | ^***| ^***  |  ||  ||  |     | |^*** |    | ||||         |||| || ||    
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_1 ..  **************  | | | |   |       |  ||  ||  |     | |  |  |    | ||||         |||| || ||    
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..      |   |    |  | | | |   |       |  ||  ||  ******* |  |  |    | ||||         |||| || ||    
search RasMol script viewer Motif-ligand binding stats  asxturn ..      |   |    |  | | | |   |       |  ||  ||  |       |  |  |    | ||||         ***| || ||    
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |   |    |  | | | |   |       ****|  |****       |  |  |    ****||          | | ****|    
search RasMol script viewer Motif-ligand binding stats  nest ..      |   |    |  | *** |   |           |  |           |  |  |      ****          ***  |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..      |   |    ****     |   |           ****           *******                         ****    
search RasMol script viewer Motif-ligand binding stats  stmotif ..      *****             *****                                                                  

chain C : DNA (5'-D(P*AP*AP*AP*TP*TP*GP*TP*TP*TP*AP*TP*AP*AP*AP*CP*AP*GP*CP*C3');
JMol viewer RasMol script viewer  MG 996B  ..                     
sec str:  .......................
sequence :  ..AAATTGTTTATAAACAGCCCG
seq num:  ..1         11         

chain D : DNA (5'-D(P*TP*TP*CP*GP*GP*GP*CP*TP*GP*TP*TP*TP*AP*TP*AP*AP*AP*CP*A3');
sec str:  .......................
sequence :  ..TTCGGGCTGTTTATAAACAAT
seq num:  ..1         11         

   New search    3g73:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors