triangle PDBeMotif: 3g2v  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification protein transport    | release date: Sun, Feb 1, 2009
Title vhs domain of human gga1 complexed with sotilin c-terminal phosphopeptide
Authors C.GUSTAFSEN, C.L.P.OLIVEIRA, C.M.PETERSEN, J.F.CRAMER, J.S.PEDERS, M.A.BEHRENS, P.MADSEN, S.S.THIRUP
Method X-RAY DIFFRACTION (resolution: 2.10Å)
PDBe Citation   
Small molecules:    search IOD IOD binding statistics IOD
Modified residues:  search SEP SEP binding statistics SEP
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GSMEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVLETCMKSCG
KRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVKS
Chains C,D sequence:
SGYHDDSDEDLLE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ADP-RIBOSYLATION FACTOR-BINDING PROTEIN GGA1
member of: CATH:search1.25.40.90GENE3D:searchG3DSA_1.25.40.90PANTHER:searchPTHR13856/searchPTHR13856_SF82PFAM:searchPF00790PROSITE PROFILES:searchPS50179, SMART:searchSM00288SUPERFAMILY:searchSSF48464UniProt:searchQ9UJY5
JMol viewer RasMol script viewer  IOD 150A  ..                                                                                                                   *   *                    
JMol viewer RasMol script viewer  IOD 149A  ..                              **                                      ** **                                        |   |                    
JMol viewer RasMol script viewer  IOD 148A  ..                              ||           *  **                      || ||                                        |   |                    
sec str:  ....hhhhhhhhhh.......hhhhhhhhhhhhh...hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh....
sequence :  ..PETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVK
seq num:  ..7         17        27        37        47        57        67        77        87        97        107       117       127       137       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |   || | || |||            || ||  |          |  | ||       |  ||   ||  |   |  |  |  |  |  ^**| |  |^** | |     |                     |||| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |   || | || |||            || ||  |          |  ^***       ^***|   ||  |   |  |  |  |  |  |  | |  |||  | |     |                     |||| 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |   || | || |||            || ||  |          |  | |        |   |   ||  |   |  |  |  |  |  |  | |  |||  | ******^                     |||| 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |   || | || |||            || ||  |          |  | |        |   |   ||  |   |  |  |  |  |  |  | ^*****  |                             |||| 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  |   || | || |||            || ||  |          |  | |        |   |   |^***   |  |  |  |  |  |  | |  ||   |                             |||| 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |   || | |*****            || ||  |          |  | |        |   |   |       |  |  |  |  |  |  | |  ||   |                             |||| 
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |   || | |***|             || ||  |          |  | |        |   |   |       |  |  |  |  |  |  | |  ||   |                             |||| 
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |   || | |****             ********          |  | |        |   |   |       |  |  ****  |  **** |  ||   |                             |||| 
search RasMol script viewer Motif-ligand binding stats  nest ..  |   || | ||  |              |  |             |  | |        |   |   |       |  |        |  |    |  ||   |                             **** 
search RasMol script viewer Motif-ligand binding stats  niche ..  |   || *******              ****             ******        |   |   |       ****        ****    ****|   |                              *** 
search RasMol script viewer Motif-ligand binding stats  stmotif ..  *****|   |                                      | |        |   |   |                               *****                                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..       *****                                      | |        *********                                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                  ***                                                                                       

chain C : C-TERMINAL FRAGMENT OF SORTILIN
member of: PANTHER:searchPTHR12106/searchPTHR12106_SF23UniProt:searchQ99523
sec str:  ...........
sequence :  ..DDSDEDLLE
seq num:  ..4        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ^***   

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : ADP-RIBOSYLATION FACTOR-BINDING PROTEIN GGA1
member of: CATH:search1.25.40.90GENE3D:searchG3DSA_1.25.40.90PANTHER:searchPTHR13856/searchPTHR13856_SF82PFAM:searchPF00790PROSITE PROFILES:searchPS50179, SMART:searchSM00288SUPERFAMILY:searchSSF48464UniProt:searchQ9UJY5
JMol viewer RasMol script viewer  IOD 149B  ..                                                     **  *                                             *                                    
JMol viewer RasMol script viewer  IOD 148B  ..                                           *  **     ||  |                                             |                                    
sec str:  ....hhhhhhhhhh.......hhhhhhhhhhhhh...hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh....
sequence :  ..PETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVK
seq num:  ..7         17        27        37        47        57        67        77        87        97        107       117       127       137       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  | ||             || ||             |  | ||       |  | |  ||| |   |  |  |  || |  ^** ||  |^** | |     |                     |||| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  | ||             || ||             |  ^***       ^*** |  ||| |   |  |  |  || |  |   ||  |||  | |     |                     |||| 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         |  | ||             || ||             |  | |             |  ||| |   |  |  |  || |  |   ||  |||  | ******^                     |||| 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  | ||             || ||             |  | |             |  ||| |   |  |  |  || |  |   |^*****  |                             |||| 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         |  | ||             || ||             |  | |             |  |^***   |  |  |  || |  |   ||  ||   |                             |||| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         |  | ||             || ||             |  | |             |  | |     |  |  ***** |  |   ||  ||   |                             |||| 
search RasMol script viewer Motif-ligand binding stats  asxturn ..         |  ***|             || ||             |  | |             |  | |     |  |  |  |  |  |   ||  ||   |                             |||| 
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  |  |             ****|             |  | |             |  | |     |  |  ****  |  |   ||  ||   |                             |||| 
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |  |              |  |             |  | |             |  | |     |  |        |  |   ||  ||   |                             **** 
search RasMol script viewer Motif-ligand binding stats  niche ..         *******              ****             ******             ******     ****        ****   |****|   |                              *** 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                  | |                                           |   |*****                                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                  | |                                           *****                                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                  ***                                                                                       

chain D : C-TERMINAL FRAGMENT OF SORTILIN
member of: PANTHER:searchPTHR12106/searchPTHR12106_SF23UniProt:searchQ99523
sec str:  .........
sequence :  ..SDEDLLE
seq num:  ..6      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***   

   New search    3g2v:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors