triangle PDBeMotif: 3fzp  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.10.2
Classification transferase    | release date: Mon, Jan 26, 2009
Title crystal structure of pyk2 complexed with atpgs
Authors S.HAN
Method X-RAY DIFFRACTION (resolution: 2.10Å)
PDBe Citation   
Small molecules:    search AGS AGS binding statistics AGS   search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
PQYGIAREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKNLDHPHIVKLIGIIEE
EPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYLESINCVHRDIAVRNILVASPECVKLGDFGLSRYIE
DEDYYKASVTRLPIKWMSPESINFRRFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLY
TLMTRCWDYDPSDRPRFTELVCSLSDVYQMEKDIAME
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN TYROSINE KINASE 2 BETA
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24418/searchPTHR24418_SF94PFAM:searchPF07714PRINTS:searchTYRKINASEPROSITE PATTERNS:searchPS00107/searchPS00109, PROSITE PROFILES:searchPS50011, SMART:searchSM00219SUPERFAMILY:searchSSF56112UniProt:searchQ14289
JMol viewer RasMol script viewer  SO4 3A  ..                                                                *                                                   *                                  ..SO4 ..                                                                                                            
JMol viewer RasMol script viewer  SO4 2A  ..                                                                |                                                   |                                  ..SO4 ..                                      *                        *                                            
JMol viewer RasMol script viewer  AGS 999A  ..               ***  *               * *                *        |                   ***   *                         |                    *           * ..AGS ..                                      |                        |                                            
sec str:  ....hhh.eeeeeeeeee..eeeeeeeee.....eeeeeeee....hhhhhhhhhhhhhhhhhhh.......eeeee.....eeeee.....hhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.......hhh.eeeee..eeee....... .....hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhhhh
sequence :  ..GIAREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKNLDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYLESINCVHRDIAVRNILVASPECVKLGDFG... ..TRLPIKWMSPESINFRRFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTRCWDYDPSDRPRFTELVCSLSDVYQMEKDIAME
seq num:  ..419       429       439       449       459       469       479       489       499       509       519       529       539       549       559        ... ..585       595       605       615       625       635       645       655       665       675       685     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  || ||     |  |  |    |    || |      || | ||  |           |  | |  |      |||  |                   | |||                    | |   | ||||| | | |||      ..PS00004..| | |  ||   | |**^*|  |        ||| |||   | ||        | |||    |  ||| |||   |  | ||| |      | | ||           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  || ||     |  |  |    |    || |      |^** ||  |           |  | |  |      |||  |                   | ^**                    | |   | ||||| | | |||      ..PS00005..| | |  ||   | | | ||  |        ||| |||   | ||        | |||    |  ||| |||   |  | ||^**      | | ||           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  || ||     |  |  |    |    || |      |  | ||  |           |  | |  |      |||  |                   |  |                     | |   | ||||| | | |||      ..PS00006..| | |  ||   | | | |^***        ||| |||   | ||        | |||    |  ||| |||   |  | ||  |      | ^***           
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  || ||     |  |  |    |    || |      |  | ||  |           |  | |  |      |||  |                   |  |                     | |   | ||||| | | |||      ..PS00007..| | |  ||   | | | |   |        ||| |||   | ||        | |||    |  ||| |||   |  | ||  |      |   |            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  || ||     |  |  |    ^*****| |      |  | ||  |           |  | |  |      |||  |                   |  |                     | |   | ||||| | | |||      ..PS00008..| | |  ||   | | | |   |        ||| |||   | ||        | |||    |  ||| |||   |  | ||  |      |   |            
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..  || ||     ***************************  | ||  |           |  | |  |      |||  |                   |  |                     | |   | ||||| | | |||      ..PS00107..| | |  ||   | | | |   |        ||| |||   | ||        | |||    |  ||| |||   |  | ||  |      |   |            
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_TYR ..  || ||        |  |          | |         | ||  |           |  | |  |      |||  |                   |  |                     | ****^******** | |||      ..PS00109..| | |  ||   | | | |   |        ||| |||   | ||        | |||    |  ||| |||   |  | ||  |      |   |            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  || ||        |  |          | |         | ||  |           |  | |  |      |||  |                   |  |                     | |   | |||||   | |||      ..alphabetamotif..| | |  ||   | | | |   |        ||| |||   | ||        | |||    |  |*****|   |  | ||  |      |   |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****|        ****          | |         | |****           **** |  |      |||  |                   |  |                     | |   | ****|   ****|      ..betaturn..| | |  ||   | | | |   |        ||****|   ****        ****|    ******** |   |  | ||  |      |   |            
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   |  |                      | |         ***               |  | |  |      |||  |                   |  |                     | |   |  || |   | |||      ..gammaturn..*** |  ||   | | | |   |        ||  | |   | ||          | |    |  | |   |   |  | ||  |      |   |            
search RasMol script viewer Motif-ligand binding stats  nest ..   |  |                      ***                           |  | |  |      |||  |                   |  |                     ***   |  || |   | |||      ..nest..    |  ||   | *** |   |        ||  ***   ***|          ***    |  | |   |   |  | ||  |      |   |            
search RasMol script viewer Motif-ligand binding stats  niche ..   ****                                                    **** ****      ***  |                   ****                           |  ****   ****|      ..niche..    ****|   |     |   |        ||  | |   ****                 **** |   |   **********      |   |            
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                           |   |                                                  |   |     | | |      ..schellmannloop..        |   |     |   |        |******                             |   |                   |   |            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                           |   |                                                  |   |     *****      ..stmotif..        *****     *****        |   |                               |   |                   |   |            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                           *****                                                  |   |     | |        ..ststaple..                               *****                               *****                   *****            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                  |   |     ***        ..stturn..                                                                                                            
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                  *   *                ..REP00000..                                                                                                            

   New search    3fzp:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors