triangle PDBeMotif: 3fo5  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification lipid transport    | release date: Sat, Dec 27, 2008
Title human start domain of acyl-coenzyme a thioesterase 11 (acot1
Authors A.FLORES, A.G.THORSELL, A.JOHANSSON, A.M.EDWARDS, C.BOUNTRA, C.H.ARROWSMITH, C.PERSSON, H., H.BERGLUND, I.JOHANSSON, J.SAGEMARK, J.WEIGELT, L.G.DAHLGREN, L.LEHTIO, L.TRES, M.E., M.HAM, M.I.SIPONEN, M.MOCHE, M.WELIN, M.WIKSTROM, M.WISNIEWSKA, P.NORDLUND, R.C, S.FLODIN, S.GRASLUND, S.VAN-DEN-BERG, STRUCTURAL GENOMICS CONSORTIUM (SGC), T.KARLBERG, T.KOTENYOVA, T.NYMAN
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search 1PE 1PE binding statistics 1PE   search GOL GOL binding statistics GOL   search CL CL binding statistics CL   search TCE TCE binding statistics TCE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
SMRPQPGDGERRYREASARKKIRLDRKYIVSCKQTEVPLSVPWDPSNQVYLSYNNVSSLKMLVAKDNWVLSSEISQVRLY
TLEDDKFLSFHMEMVVHVDAAQAFLLLSDLRQRPEWDKHYRSVELVQQVDEDDAIYHVTSPALGGHTKPQDFVILASRRK
PCDNGDPYVIALRSVTLPTHRETPEYRRGETLCSGFCLWREGDQLTKVSYYNQATPGVLNYVTTNVAGLSSEFYTTFKAC
EQFLLDNRNDLAPSLQTL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : THIOESTERASE, ADIPOSE ASSOCIATED, ISOFORM BFIT2
member of: GENE3D:searchG3DSA_3.10.129.10/searchG3DSA_3.30.530.20PANTHER:searchPTHR11049/searchPTHR11049_SF1PFAM:searchPF01852PROSITE PROFILES:searchPS50848, SMART:searchSM00234SUPERFAMILY:searchSSF54637/searchSSF55961UniProt:searchQ8WXI4
JMol viewer RasMol script viewer  TCE 596A  ..       *  *                                                  *                                                                                                                                                           *                     
JMol viewer RasMol script viewer  GOL 595A  ..       |  |                                                  |               **                                                                                                                           * **   *  *    |                     
JMol viewer RasMol script viewer  CL 1A  ..       |  |                                                  |               ||                                                         ***                                      *                        | ||   |  |    |                     
JMol viewer RasMol script viewer  1PE 2A  ..       |  |                                                  |               ||                        *      *                         |||                       *              |                      * | ||   |  |    |     *               
sec str:  ..hhhhhhhhhhhhhhhhhhh...........eee.hhhhhhhhhhhhhhhhhhhhh....eeeeee..eeeeeee....eeeeeeeee..hhhhhhhhhhhhhhhhhh.....eeeeeeeee..eeeeeeee.........eeeeeeeeee........eeeeeeeee..........ee.....eeeeeeeee..eeeeeeee..hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh.
sequence :  ..ERRYREASARKKIRLDRKYIVSCKQTEVPLSVPWDPSNQVYLSYNNVSSLKMLVAKDNWVLSSEISQVRLYTLEDDKFLSFHMEMVVHVDAAQAFLLLSDLRQRPEWDKHYRSVELVQQVDEDDAIYHVTSPALGGHTKPQDFVILASRRKPCDNGDPYVIALRSVTLPTHRETPEYRRGETLCSGFCLWREGDQLTKVSYYNQATPGVLNYVTTNVAGLSSEFYTTFKACEQFLLDNR
seq num:  ..346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |   | | |     || || || || |    |  |      |^*** | |  |  |     |  |   |  |                   |   ||| |||  |  |     ||  | ||         |  |          | |   |  |            | |||  |               |  |              |   || |||| |   | |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |   ^** |     || |^**| || |    |  |      |   ^** |  |  |     |  |   |  |                   |   ||| |||  |  |     ||  | ||         |  |          ^**   |  |            ^**||  |               |  |              |   || |||| |   ^**          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |   |   |     || |  || || |    |  |      |   |   |  |  |     |  |   ^***                   |   ||| |||  |  |     ||  | ||         |  |                |  |            ^***|  |               |  |              |   || |||| |                
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   |   |   *******^ |  || || |    |  |      |   |   |  |  |     |  |                          |   ||| |*******^     ||  | ||         |  |                |  |                |  |               |  |              |   || |||| |                
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |   |         |  |  ***** |    |  |      |   |   |  |  |     |  |                          |   ||| |||  |  |     ||  | ||         |  |                |  |                |  |               |  |              |   || |||| |                
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |   |         |  |  || || |    |  |      |   |   |  |  |     |  |                          |   ||| |||  |  |     ||  ***|         |  |                |  |                |  |               |  |              |   || |||| |                
search RasMol script viewer Motif-ligand binding stats  betabulge ..   |   |         |  |  || || |    |  |      |   |   |  |  |     |  |                          |   ||| |||  |  |     **  |  |         |  |                |  |                |  |               |  |              |   || |||| |                
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |   |         |  |  ****| |    ****      |   |   |  |  |     ****                          |   |*****|  |  |         |  |         ****                |  |                |  |               |  |              |   |****|| |                
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   |   |         |  |   |  ***              |   |   |  |  |                                   |   |     |  |  |         |  |         |  |                |  |                |  |               |  |              |   |  |||| |                
search RasMol script viewer Motif-ligand binding stats  nest ..   |   |         |  |   |  |                |   |   |  |  |                                   |   |     |  |  |         |  |         |  |                |  |                |  |               |  |              |   |  **** |                
search RasMol script viewer Motif-ligand binding stats  niche ..   |   |         ****   ****                |   |   *******                                   |   |     *******         ****         ****                ****                ****               ****              |   |    || |                
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..   |   |                                    |   |                                             |   |                                                                                                               |   ******| |                
search RasMol script viewer Motif-ligand binding stats  ststaple ..   *****                                    *****                                             *****                                                                                                               *****     | |                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                            ***                

chain B : THIOESTERASE, ADIPOSE ASSOCIATED, ISOFORM BFIT2
member of: GENE3D:searchG3DSA_3.10.129.10/searchG3DSA_3.30.530.20PANTHER:searchPTHR11049/searchPTHR11049_SF1PFAM:searchPF01852PROSITE PROFILES:searchPS50848, SMART:searchSM00234SUPERFAMILY:searchSSF54637/searchSSF55961UniProt:searchQ8WXI4
JMol viewer RasMol script viewer  1PE 1B  ..               ..                                                                          *     **                               *                   *                  *  *               * *                    *  **                   
JMol viewer RasMol script viewer  CL 1A  ..               ..                                                                          |     ||                               |                   |                  |  |               | |                    |  ||                   
sec str:  ..hhhhhhhhhhhhhh.....ee.hhhhhhhhhhhhhhhhhhhhhh...eeeeee..eeeeeee....eeeeeeeee..hhhhhhhhhhhhhhhhhh.....eeeeeeeee..eeeeeeee.........eeeeeeeeee........eeeeeeeee..........ee.....eeeeeeeee..eeeeeeee..hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh...hhhhhh
sequence :  ..ASARKKIRLDRKYIV..LSVPWDPSNQVYLSYNNVSSLKMLVAKDNWVLSSEISQVRLYTLEDDKFLSFHMEMVVHVDAAQAFLLLSDLRQRPEWDKHYRSVELVQQVDEDDAIYHVTSPALGGHTKPQDFVILASRRKPCDNGDPYVIALRSVTLPTHRETPEYRRGETLCSGFCLWREGDQLTKVSYYNQATPGVLNYVTTNVAGLSSEFYTTFKACEQFLLDNRNDLAPSLQ
seq num:  ..352       362  ..375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535       545       555       565       575       585     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | | |    | || ..     |  |       ^*** | |  |  |            |  |  |           |   ||   | |  ||  |  |     ||  |  |                       | |    | |            | |||  |               |  |         |  |        ||||     | |        |  |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ^** |    | || ..     |  |          ^** |  |  |            |  |  |           |   ||   | |  ||  |  |     ||  |  |                       ^**    | |            ^**||  |               |  |         |  |        ||||     ^**        |  |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |    | || ..     |  |              |  |  |            ^***  |           |   ||   | |  ||  |  |     ||  |  |                              | |            ^***|  |               |  |         |  |        ||||                |  |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     *******^| ..     |  |              |  |  |               |  |           |   ||   | |  *******^     ||  |  |                              | |                |  |               |  |         |  |        ||||                |  |      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          |  | ..     |  |              |  |  |               |  |           *****|   | |  ||  |  |     ||  |  |                              | |                |  |               |  |         |  |        ||||                |  |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  | ..     |  |              |  |  |               |  |                |   | |  ||  |  |     ||  |  |                              ***                |  |               |  |         |  |        ||||                |  |      
search RasMol script viewer Motif-ligand binding stats  betabulge ..          |  | ..     |  |              |  |  |               |  |                |   | |  ||  |  |     **  |  |                              | |                |  |               |  |         |  |        ||||                |  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  | ..     ****              |  |  |               |  |                |   | ****|  ****         |  |                              | |                |  |               |  |         ****        ||||                |  |      
search RasMol script viewer Motif-ligand binding stats  nest ..          |  | ..                       |  |  |               |  |                |   |     |  |  |         |  |                              ***                |  |               |  |                     ****                |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..          **** ..                       *******               ****                |   |     *******         ****                                                 ****               ****                                         ****      
search RasMol script viewer Motif-ligand binding stats  ststaple ..               ..                                                                 *****                                                                                                                                                    

   New search    3fo5:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors