triangle PDBeMotif: 3fia  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification protein binding    | release date: Thu, Dec 11, 2008
Title crystal structure of the eh 1 domain from human intersectin- 1 protein. northeast structural genomics consortium target hr3646e.
Authors C.CICCOSANTI, C.DEVICES, E.L.FOOTE, G.T.MONTELIONE, GENOMICS CONSORTIUM (NESG), J.F.HUNT, J.SEETHARAMAN, L.MAO, L.TONG, L.ZHAO, NORTHEAST STRUCTURAL, R.XIAO, S.M.VOROBIEV, T.B.ACTON, Y.CHEN
Method X-RAY DIFFRACTION (resolution: 1.45Å)
PDBe Citation   
Small molecules:    search SO4 SO4 binding statistics SO4   search CA CA binding statistics CA
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MGHHHHHHSHVAQFPTPFGGSLDTWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQIWALADMNND
GRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAISS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERSECTIN-1
member of: CATH:search1.10.238.10GENE3D:searchG3DSA_1.10.238.10PANTHER:searchPTHR11216/searchPTHR11216_SF68PFAM:searchPF12763PRINTS:searchP67PHOX/searchSH3DOMAINPROSITE PATTERNS:searchPS00018, PROSITE PROFILES:searchPS50031/searchPS50222, SMART:searchSM00027/searchSM00054SUPERFAMILY:searchSSF47473UniProt:searchQ15811
JMol viewer RasMol script viewer  SO4 301A  ..               *                                                                *   *             
JMol viewer RasMol script viewer  CA 201A  ..               |                                            * * * *    *        |   |             
sec str:  ..............hhhhhhhhhhhhhhh......eehhhhhhhhhhhh.hhhhhhhhhhhhh.....eehhhhhhhhhhhhhhhhh........hhhhh
sequence :  ..TPFGGSLDTWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQIWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMK
seq num:  ..6         16        26        36        46        56        66        76        86        96      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | |  | || |  |        |^**                 | |            | ||||| |  ||         | |||      |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | |  | || ^***        |  |                 | |            | ||||| |  ||         | |||      |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | ^*****|             |  |                 | |            | ||||| |  ||         | |||      |  | 
search RasMol script viewer Motif-ligand binding stats  EF_HAND_1 ..  | |  |  |             |  |                 | |            ^*^*^*^*^**^*         | |||      |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |  |  |             ****                 | |            ****|||               ****|      **** 
search RasMol script viewer Motif-ligand binding stats  nest ..  ***  |  |                                  ***              *****                 ***           
search RasMol script viewer Motif-ligand binding stats  niche ..       ****                                  | |                                                  
search RasMol script viewer Motif-ligand binding stats  stturn ..                                             ***                                                  

   New search    3fia:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors