triangle PDBeMotif: 3eug  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.2.2.3
Classification hydrolase    | release date: Tue, Oct 13, 1998
Title crystal structure of escherichia coli uracil dna glycosylase complexes with uracil and glycerol: structure and glycosyla mechanism revisited
Authors A.C.DROHAT, G.L.GILL, G.XIAO, J.JAGADEESH, J.T.STIVERS, M.TORDOVA
Method X-RAY DIFFRACTION (resolution: 1.43Å)
PDBe Citation   
Small molecules:    search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MANELTWHDVLAEEKQQPHFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVR
PGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVV
FLLWGSHAQKKGAIIDKQRHHVLKAPHPSPLSAHRGFFGCNHFVLANQWLEQHGETPIDWMPVLPAESE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (GLYCOSYLASE)
member of: CATH:search3.40.470.10GENE3D:searchG3DSA_3.40.470.10HAMAP:searchMF_00148PANTHER:searchPTHR11264/searchPTHR11264_SF4PFAM:searchPF03167PROSITE PATTERNS:searchPS00130, SMART:searchSM00986/searchSM00987SUPERFAMILY:searchSSF52141TIGRFAMS:searchTIGR00628UniProt:searchP12295
JMol viewer RasMol script viewer  GOL 231A  ..  *   *   *                             *  *                                                                                                                                                                                     
JMol viewer RasMol script viewer  GOL 230A  ..  |   |   |                             |  |              ** *         **                                             *                                                               *                                          
sec str:  ....hhhhh..hhh.hhhhhhhhhhhhhhhh.......hhh..hhhhh..hhh..eeeee........................hhhhhhhhhhh..............hhhhhh.eeeee.................hhhhhhhhhhhhhhh....eeeee.hhhhhh.........eeeee.......hhh......hhhhhhhhhhh.................
sequence :  ..LTWHDVLAEEKQQPHFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLLLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHHVLKAPHPSPLSAHRGFFGCNHFVLANQWLEQHGETPIDWMPVLPAESE
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |   || || ||| |     ^** | |    |  |    |  ||| |||      | | | | |  |  ^**  |           ||| ||  |    | |   |  | |       ^** || ||||     | ^**     |  |  |          | || |||| |      | | ||| |||||||||       | ||||  | |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***   || || ||| |      |  | |    |  |    |  ||| |||      | | | | |  |  | |  |           ||| ||  |    | |   |  | |         | || ||||     ^***      |  |  |          | || |||| |      | | ||| |||||||||       | |||^*** |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        || || ||| |      |  | |    |  |    |  ||| |||      | | | ^*****  | |  |           ||| ||  |    | |   |  | |         | ^*****|               |  |  |          | || |||| |      | | ||| |||||||||       | |||   | |        
search RasMol script viewer Motif-ligand binding stats  U_DNA_GLYCOSYLASE ..        || || ||| |      |  | |    |  |    |  ||| ||*******^** | | |  |  | |  |           ||| ||  |    | |   |  | |         |  | ||||               |  |  |          | || |||| |      | | ||| |||||||||       | |||   | |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        || |***** |      |  | |    |  |    |  |*****       | | | | |  |  | |  |           |*****  |    | |   |  | |         |  | ||||               |  |  |          | || |||| |      | ***** |||||||||       | |||   | |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..        || || ||  |      |  | |    |  |    |  ||| ||       | | | | |  |  | |  |           ||| ||  |    | |   |  | |         |  | ||||               |  |  |          | || |*** |      | | ||| |||||||||       | |||   | |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ********  |      **** |    ****    |  |****|       | | | | |  |  | ****           |********    | |   **** |         *********               |  |  |          **** | |  |      | *******||||||||       ****|   | |        
search RasMol script viewer Motif-ligand binding stats  nest ..         |  | |   |         ***            |  | |  |       | | | ***  |  | |  |           | | ||  |    | |      ***              ***                |  |  |            |  | |  |      | | ||| *********         ***   | |        
search RasMol script viewer Motif-ligand binding stats  niche ..         **** |   |                        **** ****       | ***      **** ****           | *******    ***                                          *******            **** ****      *** |||                         ***        
search RasMol script viewer Motif-ligand binding stats  stmotif ..              |   |                                        |                              |   |                                                                                       | *****                                    
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                        |                              *****                                                                                       ******                                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                           |                                                                                                                          | ***                                      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                           *                                                                                                                          *                                          

   New search    3eug:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML