triangle PDBeMotif: 3elp  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   4.4.1.1
Classification lyase    | release date: Tue, Sep 23, 2008
Title structure of cystationine gamma lyase
Authors J.SIVARAMAN, Q.SUN
Method X-RAY DIFFRACTION (resolution: 2.40Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains B,A,C,D sequence:
GSPNSMQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAV
AALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVW
IETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNR
LRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVT
FYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALK
AAHPPSGSHS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : CYSTATHIONINE GAMMA-LYASE
member of: GENE3D:searchG3DSA_3.40.640.10/searchG3DSA_3.90.1150.10PANTHER:searchPTHR11808/searchPTHR11808_SF15PFAM:searchPF01053PIRSF:searchPIRSF001434PROSITE PATTERNS:searchPS00868, SUPERFAMILY:searchSSF53383UniProt:searchP32929
sec str:  ..........hhhhhhhhh.....hhhhhhhhhhhhhhh...eeeee.hhhhhhhhhhh......eeeee.......hhhhhhhhhhhhheeeee...hhhhhhhhh...eeeeeee..........hhhhhhhhhhhh...eeeee.........hhhhhh..eeeeee...........eeeeee.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeee........hhhhhhh.......eeeeee..hhhhhhhhhhhh...ee.........eeehhhhh... ........eeeee....hhhhhhhhhhhhhhhh..
sequence :  ..QGFLPHFQHFATQAIHVGQ..GNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIM... ..LGISDTLIRLSVGLEDEEDLLEDLDQALKAAHP
seq num:  ..9         19       ..64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344        ... ..367       377       387          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | |  |  |  ..             | |||   |    |    || || ||  |        || ^**         |   ||||| |  ||| |||  |           ^**    |  ||            | |   |  | |  ||||  |   || |   | |      | |        |   || |  |  |                     |    | |  | ||    |  |  |     || ||   | |       |  ||   |  |  || ||| || ||| |     ..PS00005.. | |  |                    |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | |  |  |  ..             | |||   |    |    || || ||  |        || |           |   ^***| |  ||| |||  |           | |    |  ||            | |   |  | |  ||||  |   || |   | |      | |        |   || |  ^***                     |    | |  | ||    |  |  |     || ||   | |       |  ||   |  |  |^***| || |^***     ..PS00006.. | |  |                    |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        | |  |  |  ..             | |^*****    ^*****| || ||  |        || |           ^*****||| |  ||| |||  |           | |    |  ||            | |   |  | |  |^*****   || |   | |      | |        |   || |                           ^***** |  | ||    |  |  |     || ||   | |       |  ||   |  |  |  | | ^*****       ..PS00008.. ^*****                    |     
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..        | |  |  |  ..             | |||              | || ||  |        || |                 ||| |  ||| |||  |           | |    |  ||            | |   |  | |  | ||      || |   | |      | |        |   || |                                  |  | ||    |  |  |     || ||   | |       |  ||   |  |  |  | |  | |         ..PS00029..   |  **********************     
search RasMol script viewer Motif-ligand binding stats  CYS_MET_METAB_PP ..        | |  |  |  ..             | |||              | || ||  |        || |                 ||| |  ||| |||  |           | |    |  ||            | |   |  | |  | |*******^******* |      | |        |   || |                                  |  | ||    |  |  |     || ||   | |       |  ||   |  |  |  | |  | |         ..PS00868..   |  |                          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | |  |  |  ..             | |||              | || ||  |        || |                 ||| *********|  |           | |    *****            | |   |  | |  | |       || |   | |      | |        |   || |                                  |  | ||    |  |  |     || ||   | |       *****   |  |  |  | |  | |         ..alphabetamotif..   |  |                          
search RasMol script viewer Motif-ligand binding stats  asxturn ..        | |  |  |  ..             | |||              | || ||  |        || |                 ||| |  ||| |||  |           | |    |  |             ***   |  | |  | |       || |   | |      | |        |   || |                                  |  ***|    |  |  |     || ||   | |       |  |    |  |  |  | |  | |         ..asxturn..   |  |                          
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |  |  |  ..             ****|              **** |****        || |                 |***********|****           | |    ****             |     |  | **** |       || |   | |      | |        |   || |                                  |  |  |    |  |  |     ****|   | |       ****    |  |  |  | |  | |         ..betaturn..   |  |                          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |  |  |  ..               | |                |  ||  |        || |                 ***      |  ||  |           | |                     |     |  |    | |       || |   ***      | |        |   || |                                  |  |  |    |  |  |      |  |   | |               |  |  |  | |  | |         ..gammaturn..   |  |                          
search RasMol script viewer Motif-ligand binding stats  nest ..        ***  |  |  ..               ***                |  ||  |        || |                          |  ||  |           ***                     |     |  |    ***       || |            | |        |   |***                                  |  |  |    |  |  |      |  |   | |               |  |  |  | |  | |         ..nest..   |  |                          
search RasMol script viewer Motif-ligand binding stats  niche ..             ****  ..                                  ********        |***                          ********                                   |     ****              ****            ***        |   |                                     *******    *******      ****   ***               *******  ***  ***         ..niche..   ****                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                   ..                                                  |                                                                        |                        |                         *****                                                                                                                ..ststaple..                                 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                   ..                                                  *                                                                        *                        *                                                                                                                                              ..REP00000..                                 

chain A : CYSTATHIONINE GAMMA-LYASE
member of: CATH:search3.40.640.10/search3.90.1150.10GENE3D:searchG3DSA_3.40.640.10/searchG3DSA_3.90.1150.10PANTHER:searchPTHR11808/searchPTHR11808_SF15PFAM:searchPF01053PIRSF:searchPIRSF001434PROSITE PATTERNS:searchPS00868, SUPERFAMILY:searchSSF53383UniProt:searchP32929
sec str:  ..........hhhhhhhhh.....hhhhhhhhhhhhhhh...eeeee.hhhhhhhhhhh......eeeee.......hhhhhhhhhh...eeeee...hhhhhhhhh...eeeeeee..........hhhhhhhhhhhh...eeeee.hhh.....hhhhhh..eeeeee...........eeeeee.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeee........hhhhhhh.......eeeeee..hhhhhhhhhhhh...ee.........eeehhhhh... ........eeeee....hhhhhhhhhhhhhhhh..
sequence :  ..QGFLPHFQHFATQAIHVGQ..GNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIM... ..LGISDTLIRLSVGLEDEEDLLEDLDQALKAAHP
seq num:  ..9         19       ..64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344        ... ..367       377       387          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | |  | || |..            || |||   |    |   ||  |  |            |  ^**|        |   || | ||  |  | ||  |           ^**  |   |              | |   |  | |  ||||  |   || | | | |      | |        |   || |  | ||       |  |          |    | |  | ||    |  |  | |  |||  |   | |       |  ||  || ||| ||  |  || ||| |     ..PS00005.. | |  |     | |            |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | |  | || |..            || |||   |    |   ||  |  |            |   | |        |   ^*** ||  |  | ||  |           | |  |   |              | |   |  | |  ||||  |   || | | | |      | |        |   || |  ^***       |  |          |    | |  | ||    |  |  | |  |||  |   | |       |  ||  || ||| |^***  || |^***     ..PS00006.. | |  |     | |            |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        | |  | || |..            || |^*****    ^*****  |  |            |   | |        ^***** | ||  |  | ||  |           | |  |   |              | |   |  | |  |^*****   || | | | |      | |        |   || |  | |        |  |          ^***** |  | ||    |  |  | |  |||  |   | |       |  ||  || ||| |      ^*****       ..PS00008.. ^*****     | |            |     
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..        | |  | || |..            || |||        |   |   |  |            |   | |               | ||  |  | ||  |           | |  |   |              | |   |  | |  | ||      || | | | |      | |        |   || |  | |        |  |                 |  | ||    |  |  | |  |||  |   | |       |  ||  || ||| |       | |         ..PS00029..   |  **********************     
search RasMol script viewer Motif-ligand binding stats  CYS_MET_METAB_PP ..        | |  | || |..            || |||        |   |   |  |            |   | |               | ||  |  | ||  |           | |  |   |              | |   |  | |  | |*******^******* |      | |        |   || |  | |        |  |                 |  | ||    |  |  | |  |||  |   | |       |  ||  || ||| |       | |         ..PS00868..   |  |     | |                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | |  | || |..            || |||        |   |   |  |            |   | |               | ||  |  | ||  |           | |  |   |              | |   |  | |  | |        | | | | |      | |        |   || |  | |        |  |                 |  | ||    |  |  | *****|  |   | |       *****  *****| |       | |         ..alphabetamotif..   |  |     | |                  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..        | |  | || |..            || |||        |   |   |  |            |   | |               | ||  |  | ||  |           | |  *****              | |   |  | |  | |        | | | | |      | |        |   || |  | |        |  |                 |  | ||    |  |  | |  | |  |   | |       |  |   || ||| |       | |         ..asxmotif..   |  |     | |                  
search RasMol script viewer Motif-ligand binding stats  asxturn ..        | |  | || |..            || |||        |   |   |  |            |   | |               ***|  |  | ||  |           | |                     ***   |  | |  | |        | | | | |      | |        |   || |  | |        |  |                 |  ***|    |  |  | |  | |  |   | |       |  |   || ||| |       | |         ..asxturn..   |  |     | |                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |  | ****..            |****|        |   |   ****            |   | |               |  ****  | |****           | |                     |     |  | **** |        | | | | |      | |        |   || |  | |        ****                 ****  |    |  |  | **** |  |   | |       ****   ****|| |       | |         ..betaturn..   |  |     | |                  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |  |  |  ..            |  | |        |   |   |  |            |   | |               |  |     | ||  |           | |                     |     |  |    | |        | *** ***      | |        |   || |  | |                             |  |  |    |  |  |      |  |   | |               |  || |       | |         ..gammaturn..   |  |     | |                  
search RasMol script viewer Motif-ligand binding stats  nest ..        ***  |  |  ..            |  ***        |   |   |  |            |   | |               |  |     | ||  |           ***                     |     |  |    ***        |              | |        |   |***  | |                             |  |  |    |  |  |      |  |   | |               |  || |       | |         ..nest..   |  |     | |                  
search RasMol script viewer Motif-ligand binding stats  niche ..             ****  ..            |    |        |   |   ****            |   ***               ****     *******                                   |     ****               |              ***        |   |     | |                             *******    *******      ****   ***               *******       ***         ..niche..   ****     ***                  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                   ..            ******        |   |                   |                                                                        |                        |                         |   |     | |                                                                                                        ..schellmannloop..                                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                   ..                          *****                   |                                                                        |                        |                         *****     | |                                                                                                        ..ststaple..                                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                   ..                                                  |                                                                        |                        |                                   ***                                                                                                        ..stturn..                                 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                   ..                                                  *                                                                        *                        *                                                                                                                                              ..REP00000..                                 

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : CYSTATHIONINE GAMMA-LYASE
member of: GENE3D:searchG3DSA_3.40.640.10/searchG3DSA_3.90.1150.10PANTHER:searchPTHR11808/searchPTHR11808_SF15PFAM:searchPF01053PIRSF:searchPIRSF001434PROSITE PATTERNS:searchPS00868, SUPERFAMILY:searchSSF53383UniProt:searchP32929
sec str:  ..........hhhhhhhhh.....hhhhhhhhhhhhhhh...eeeee.hhhhhhhhhhh......eeeee.......hhhhhhhhhhhhheeeee...hhhhhhhhh...eeeeeee..........hhhhhhhhhhhh...eeeee.........hhhhhh..eeeeee...........eeeeee.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeee........hhhhhhh.......eeeeee..hhhhhhhhhhhh...ee.........eeehhhhh... ........eeeee....hhhhhhhhhhhhhhhh..
sequence :  ..QGFLPHFQHFATQAIHVGQ..GNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIM... ..LGISDTLIRLSVGLEDEEDLLEDLDQALKAAHP
seq num:  ..9         19       ..64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344        ... ..367       377       387          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | |  |  |  ..             | |||   |    |    || || ||  |        || ^**         |   ||||| |  ||| |||  |           ^**    |  ||            | |   |  ||| |||||  |   || |   | |      | |        |   || |  |  |                     |    | |  | ||    |  |  |     || ||   | |       |  ||   |  |  || ||| || ||| |     ..PS00005.. | |  |                    |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | |  |  |  ..             | |||   |    |    || || ||  |        || |           |   ^***| |  ||| |||  |           | |    |  ||            | |   |  ||| |||||  |   || |   | |      | |        |   || |  ^***                     |    | |  | ||    |  |  |     || ||   | |       |  ||   |  |  |^***| || |^***     ..PS00006.. | |  |                    |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        | |  |  |  ..             | |^*****    ^*****| || ||  |        || |           ^*****||| |  ||| |||  |           | |    |  ||            | |   |  ||| ||^*****   || |   | |      | |        |   || |                           ^***** |  | ||    |  |  |     || ||   | |       |  ||   |  |  |  | | ^*****       ..PS00008.. ^*****                    |     
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..        | |  |  |  ..             | |||              | || ||  |        || |                 ||| |  ||| |||  |           | |    |  ||            | |   |  ||| || ||      || |   | |      | |        |   || |                                  |  | ||    |  |  |     || ||   | |       |  ||   |  |  |  | |  | |         ..PS00029..   |  **********************     
search RasMol script viewer Motif-ligand binding stats  CYS_MET_METAB_PP ..        | |  |  |  ..             | |||              | || ||  |        || |                 ||| |  ||| |||  |           | |    |  ||            | |   |  ||| || |*******^******* |      | |        |   || |                                  |  | ||    |  |  |     || ||   | |       |  ||   |  |  |  | |  | |         ..PS00868..   |  |                          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | |  |  |  ..             | |||              | || ||  |        || |                 ||| *********|  |           | |    *****            | |   |  |***** |       || |   | |      | |        |   || |                                  |  | ||    |  |  |     || ||   | |       *****   |  |  |  | |  | |         ..alphabetamotif..   |  |                          
search RasMol script viewer Motif-ligand binding stats  asxturn ..        | |  |  |  ..             | |||              | || ||  |        || |                 ||| |  ||| |||  |           | |    |  |             ***   |  ||| || |       || |   | |      | |        |   || |                                  |  ***|    |  |  |     || ||   | |       |  |    |  |  |  | |  | |         ..asxturn..   |  |                          
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |  |  |  ..             ****|              **** |****        || |                 |***********|****           | |    ****             |     |  |***** |       || |   | |      | |        |   || |                                  |  |  |    |  |  |     ****|   | |       ****    |  |  |  | |  | |         ..betaturn..   |  |                          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |  |  |  ..               | |                |  ||  |        || |                 ***      |  ||  |           | |                     |     |  |    | |       || |   ***      | |        |   || |                                  |  |  |    |  |  |      |  |   | |               |  |  |  | |  | |         ..gammaturn..   |  |                          
search RasMol script viewer Motif-ligand binding stats  nest ..        ***  |  |  ..               ***                |  ||  |        || |                          |  ||  |           ***                     |     |  |    ***       || |            | |        |   |***                                  |  |  |    |  |  |      |  |   | |               |  |  |  | |  | |         ..nest..   |  |                          
search RasMol script viewer Motif-ligand binding stats  niche ..             ****  ..                                  ********        |***                          ********                                   |     ****              ****            ***        |   |                                     *******    *******      ****   ***               *******  ***  ***         ..niche..   ****                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                   ..                                                  |                                                                        |                        |                         *****                                                                                                                ..ststaple..                                 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                   ..                                                  *                                                                        *                        *                                                                                                                                              ..REP00000..                                 

chain D : CYSTATHIONINE GAMMA-LYASE
member of: GENE3D:searchG3DSA_3.40.640.10/searchG3DSA_3.90.1150.10PANTHER:searchPTHR11808/searchPTHR11808_SF15PFAM:searchPF01053PIRSF:searchPIRSF001434PROSITE PATTERNS:searchPS00868, SUPERFAMILY:searchSSF53383UniProt:searchP32929
sec str:  ..........hhhhhhhhh.....hhhhhhhhhhhhhhh...eeeee.hhhhhhhhhhh......eeeee.......hhhhhhhhhh...eeeee...hhhhhhhhh...eeeeeee..........hhhhhhhhhhhh...eeeee...hhhhhhhhhhhh..eeeeee...........eeeeee.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeee........hhhhhhh.......eeeeee..hhhhhhhhhhhh...ee.........eeehhhhh... ........eeeee....hhhhhhhhhhhhhhhh..
sequence :  ..QGFLPHFQHFATQAIHVGQ..GNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIM... ..LGISDTLIRLSVGLEDEEDLLEDLDQALKAAHP
seq num:  ..9         19       ..64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344        ... ..367       377       387          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | |  | || |..            || |||   |    |   ||  |  |            |  ^**|        |   || | ||  |  | ||  |           ^**  |   |              | |   |  | |  ||||  |   || | | | |      | |        |   || |  | ||       |  |          |    | |  | ||    |  |  | |  |||  |   | |       |  ||  || ||| ||  |  || ||| |     ..PS00005.. | |  |     | |            |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | |  | || |..            || |||   |    |   ||  |  |            |   | |        |   ^*** ||  |  | ||  |           | |  |   |              | |   |  | |  ||||  |   || | | | |      | |        |   || |  ^***       |  |          |    | |  | ||    |  |  | |  |||  |   | |       |  ||  || ||| |^***  || |^***     ..PS00006.. | |  |     | |            |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        | |  | || |..            || |^*****    ^*****  |  |            |   | |        ^***** | ||  |  | ||  |           | |  |   |              | |   |  | |  |^*****   || | | | |      | |        |   || |  | |        |  |          ^***** |  | ||    |  |  | |  |||  |   | |       |  ||  || ||| |      ^*****       ..PS00008.. ^*****     | |            |     
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..        | |  | || |..            || |||        |   |   |  |            |   | |               | ||  |  | ||  |           | |  |   |              | |   |  | |  | ||      || | | | |      | |        |   || |  | |        |  |                 |  | ||    |  |  | |  |||  |   | |       |  ||  || ||| |       | |         ..PS00029..   |  **********************     
search RasMol script viewer Motif-ligand binding stats  CYS_MET_METAB_PP ..        | |  | || |..            || |||        |   |   |  |            |   | |               | ||  |  | ||  |           | |  |   |              | |   |  | |  | |*******^******* |      | |        |   || |  | |        |  |                 |  | ||    |  |  | |  |||  |   | |       |  ||  || ||| |       | |         ..PS00868..   |  |     | |                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | |  | || |..            || |||        |   |   |  |            |   | |               | ||  |  | ||  |           | |  |   |              | |   |  | |  | |        | | | | |      | |        |   || |  | |        |  |                 |  | ||    |  |  | *****|  |   | |       *****  *****| |       | |         ..alphabetamotif..   |  |     | |                  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..        | |  | || |..            || |||        |   |   |  |            |   | |               | ||  |  | ||  |           | |  *****              | |   |  | |  | |        | | | | |      | |        |   || |  | |        |  |                 |  | ||    |  |  | |  | |  |   | |       |  |   || ||| |       | |         ..asxmotif..   |  |     | |                  
search RasMol script viewer Motif-ligand binding stats  asxturn ..        | |  | || |..            || |||        |   |   |  |            |   | |               ***|  |  | ||  |           | |                     ***   |  | |  | |        | | | | |      | |        |   || |  | |        |  |                 |  ***|    |  |  | |  | |  |   | |       |  |   || ||| |       | |         ..asxturn..   |  |     | |                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |  | ****..            |****|        |   |   ****            |   | |               |  ****  | |****           | |                     |     |  | **** |        | | | | |      | |        |   || |  | |        ****                 ****  |    |  |  | **** |  |   | |       ****   ****|| |       | |         ..betaturn..   |  |     | |                  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |  |  |  ..            |  | |        |   |   |  |            |   | |               |  |     | ||  |           | |                     |     |  |    | |        | *** ***      | |        |   || |  | |                             |  |  |    |  |  |      |  |   | |               |  || |       | |         ..gammaturn..   |  |     | |                  
search RasMol script viewer Motif-ligand binding stats  nest ..        ***  |  |  ..            |  ***        |   |   |  |            |   | |               |  |     | ||  |           ***                     |     |  |    ***        |              | |        |   |***  | |                             |  |  |    |  |  |      |  |   | |               |  || |       | |         ..nest..   |  |     | |                  
search RasMol script viewer Motif-ligand binding stats  niche ..             ****  ..            |    |        |   |   ****            |   ***               ****     *******                                   |     ****               |              ***        |   |     | |                             *******    *******      ****   ***               *******       ***         ..niche..   ****     ***                  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                   ..            ******        |   |                   |                                                                        |                        |                         |   |     | |                                                                                                        ..schellmannloop..                                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                   ..                          *****                   |                                                                        |                        |                         *****     | |                                                                                                        ..ststaple..                                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                   ..                                                  |                                                                        |                        |                                   ***                                                                                                        ..stturn..                                 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                   ..                                                  *                                                                        *                        *                                                                                                                                              ..REP00000..                                 

   New search    3elp:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors