triangle PDBeMotif: 3ecs  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification translation    | release date: Mon, Sep 1, 2008
Title crystal structure of human eif2b alpha
Authors INITIATIVE (RSGI), RIKEN STRUCTURAL GENOMICS/PROTEO, S.YOKOYAMA, T.B.HIYAMA, T.ITO
Method X-RAY DIFFRACTION (resolution: 2.65Å)
PDBe Citation   
Small molecules:    search SO4 SO4 binding statistics SO4   search CL CL binding statistics CL
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D,E,F,G,H sequence:
MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLAS
LEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLS
GKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFP
LNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYLAAAEHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT ALPH
member of: CATH:search3.40.50.10470GENE3D:searchG3DSA_3.40.50.10470PANTHER:searchPTHR10233/searchPTHR10233_SF18PFAM:searchPF01008SUPERFAMILY:searchSSF100950UniProt:searchQ14232
JMol viewer RasMol script viewer  SO4 510F  ..                                      ..                                   ..                     *                                                                                                                                              ..SO4 ..                                          
JMol viewer RasMol script viewer  CL 601A  ..                                      ..                                   ..                   * |                         *                                                                                                                    ..CL ..                                          
JMol viewer RasMol script viewer  SO4 509A  ..                                      ..                                   ..                   | |         **              |         *                                                                                                          ..SO4 ..                                          
JMol viewer RasMol script viewer  SO4 501A  ..                                      ..                                   ..                   | |         ||         ***  |         |                                                                                       *                  ..SO4 ..                                          
sec str:  ...hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.....hhhhhhhhhhhhh......hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeee...hhhhhhhhhhhhh....eeeeee.....hhhhhhhhhhhh....eeeehhhhhhhhhhhh.eeeee..ee.....eeee.hhhhhhhhhhhh...eeee.hhhhh......hhhhhhhhhh.... .........eeeehhhhh.eeee..eeehhhhhhhhhhhhhh..
sequence :  ..MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDK..QGLRANLTSAIETLCGVDSSVAVSSGGELFLRFIS..CKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKY... ..LKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYLAA
seq num:  ..1         11        21        31      ..43        53        63        73   ..89        99        109       119       129       139       149       159       169       179       189       199       209       219       229       239       249 ... ..266       276       286       296         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |       |  | | ||    ||  || |  |   .. | ||^*** |||  |    |   |  |  |  | ..  |  ||     || ||          |  ||  |                 || ||| ||    ||| ||||||    |  | |     |  |    |  |       ||   |||   | |||      | |||       | ||      ||| | |  | ..PS00001..           || ||    |  |                  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | |       |  | | ||    ||  || |  |   .. | || ||| |||  |    |   |  |  |  | ..  |  ||     |**^*          |  ||  |                 || ||**^*    ||| ||||||    |  | |     |  |    |  |       ||   |||   | |||      | |||       | ||      ||| | |  | ..PS00004..           || ||    |  |                  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |       |  | | ||    ||  || |  |   .. | || ||| |||  |    |   |  |  |  | ..  |  ||     |   |          |  ||  |                 || |||       ||| ||^**|    |  | |     |  |    |  |       ||   |||   | |||      | |||       ^**|      ||| | |  | ..PS00005..           || ||    |  |                  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |       |  | | ||    ||  ^***  |   .. | || ||^***|  |    |   ^***  |  | ..  |  ||     |   |          |  ||  |                 || |||       |^***||| |    |  | |     |  |    |  |       ||   |||   | |||      | |||       |  |      ||| | |  | ..PS00006..           || ||    |  |                  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |       |  | | ||    ||  || |  |   .. ^*****|| | |  ^*****         |  | ..  |  ||     |   |          |  ||  |                 || |||       | | |||| |    |  | |     |  |    |  |       |^*****|   | |||      | |||       |  |      ||| | |  | ..PS00008..           || ||    |  |                  
search RasMol script viewer Motif-ligand binding stats  AMIDATION .. | |       |  | | ||    ||  || |  |   ..   || ||| | |  |              |  | ..  |  ||     |   |          |  ||  |                 || |||       | | ||^***    |  | |     |  |    |  |       ||   | |   | |||      | |||       |  |      ||| | |  | ..PS00009..           || ||    |  |                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |       |  | | ||    |***** |  |   ..   *****| | |  |              |  | ..  *****     |   |          |  ||  |                 || |||       | | ||||      |  | |     |  |    |  |       ||   | |   | |||      | |||       |  |      ||| | |  | ..alphabetamotif..           || ||    |  |                  
search RasMol script viewer Motif-ligand binding stats  asxturn .. ***       |  | ***|    ||  |  |  |   ..   || ||| | |  |              |  | ..  |  |      |   |          |  ||  |                 || |||       | | ||||      |  | |     |  |    |  |       ||   ***   | |||      | |||       |  |      *** | |  | ..asxturn..           || ||    |  |                  
search RasMol script viewer Motif-ligand binding stats  betabulge ..           |  | |  |    ||  |  |  |   ..   || ||| | |  |              |  | ..  |  |      |   |          |  ||  |                 || |||       | | ||||      |  | |     |  |    |  |       **   | |   | |||      | |||       |  |       |  | |  | ..betabulge..           || ||    |  |                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..           **** |  |    |****  ****   ..   ******** ****              |  | ..  ****      |   |          |  ||  |                 |****|       | | ||||      **** |     ****    |  |            | |   ****|      ****|       |  |       |  | **** ..betaturn..           *****    ****                  
search RasMol script viewer Motif-ligand binding stats  nest ..                |  |    |   |         ..    |   |                     |  | ..            |   |          |  ||  |                 |  ***       *** ****         ***             |  |            ***     ***        ***       |  |       |  |      ..nest..            |  |                          
search RasMol script viewer Motif-ligand binding stats  niche ..                ****    |   |         ..    |   |                     **** ..            |   |          ********                 |    |                                        ****                                         ****       ****      ..niche..            ****                          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                        |   |         ..    |   |                          ..            |   |                                   ******                                                                                                          ..schellmannloop..                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                        *****         ..    *****                          ..            *****                                                                                                                                                   ..ststaple..                                          

chain B : TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT ALPH
member of: CATH:search3.40.50.10470GENE3D:searchG3DSA_3.40.50.10470PANTHER:searchPTHR10233/searchPTHR10233_SF18PFAM:searchPF01008SUPERFAMILY:searchSSF100950UniProt:searchQ14232
JMol viewer RasMol script viewer  SO4 502B  ..                                      ..                                   ..                                            ***                                                                                                    *                  ..SO4 ..                                          
sec str:  ...hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhh..hhhhhhhhhhhhhh........hhhhhhhhhhhhhh.hhhhhhhhhhhhhh....eeee...hhhhhhhhhhhhh.....eeeee.....hhhhhhhhhhhhh...eeeehhhhhhhhhh...eeeee..ee.....eeee.hhhhhhhhhhhh...eeee.hhhhh......hhhhhhhhhhh... ...ee....eeeehhhhh.eeee..eeehhhhhhhhhhhhhhh.
sequence :  ..MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDK..QGLRANLTSAIETLCGVDSSVAVSSGGELFLRFIS..SKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKY... ..LKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYLAA
seq num:  ..1         11        21        31      ..43        53        63        73   ..87        97        107       117       127       137       147       157       167       177       187       197       207       217       227       237       247   ... ..266       276       286       296         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       |  ||  ||| ||        |  |      .. |  |^***  |   |    |   |  |  |  | ..               | ||     |  |||  ||  |       |   |     || ||| ||    ||| ||||||     | |||     |  |    |  |       || | |||   | |||      | |||       | ||| |    |  | |  | ..PS00001..            |  |    | |||  |  |      |  | 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..       |  ||  ||| ||        |  |      .. |  ||| |  |   |    |   |  |  |  | ..               **^*     |  |||  ||  |       |   |     || ||**^*    ||| ||||||     | |||     |  |    |  |       || | |||   | |||      | |||       | ||| |    |  | |  | ..PS00004..            |  |    | |||  |  |      |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       |  ||  ||| ||        |  |      .. |  ||| |  |   |    |   |  |  |  | ..                        |  |||  ||  |       |   |     || |||       ||| ||^**|     | |||     |  |    |  |       || | |||   | |||      | |||       ^**|| |    |  | |  | ..PS00005..            |  |    | |||  |  |      |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       |  ||  ||| ||        ^***      .. |  ||| ^***   |    |   ^***  |  | ..                        |  |||  ||  |       |   |     || |||       |^***||| |     | |||     |  |    |  |       || | |||   | |||      | |||       |  || |    |  | |  | ..PS00006..            |  |    | |||  |  |      |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       |  ||  ||| ||                  .. ^***** |      ^*****         |  | ..                        |  |||  ||  |       |   |     || |||       | | |||| |     | |||     |  |    |  |       |^*****|   | |||      | |||       |  || |    |  | |  | ..PS00008..            |  |    | |||  |  |      |  | 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..       |  ||  ||| ||                  ..    ||  |                     |  | ..                        |  |||  ||  |       |   |     || |||       | | ||^***     | |||     |  |    |  |       || | |||   | |||      | |||       |  || |    |  | |  | ..PS00009..            |  |    | |||  |  |      |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       *********| ||                  ..    ||  |                     |  | ..                        *****|  ||  |       |   |     || |||       | | ||||       | |||     |  |    |  |       || | |||   | |||      | |||       |  || |    |  | |  | ..alphabetamotif..            |  |    | |||  |  |      |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..       |  ||  | ***|                  ..    ||  |                     |  | ..                        |  | |  ||  |       |   |     || |||       | | ||||       | |||     |  |    |  |       || | ***   | |||      | |||       |  || |    |  | |  | ..asxturn..            |  |    | |||  |  |      |  | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..       |  ||  | |  |                  ..    ||  |                     |  | ..                        |  | |  ||  |       |   |     || |||       | | ||||       | |||     |  |    |  |       ** | |||   | |||      | |||       |  || |    |  | |  | ..betabulge..            |  |    | |||  |  |      |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ******** |  |                  ..    |****                     |  | ..                        **** |  |****       |   |     |****|       | | ||||       ****|     ****    |  |          ****|   ****|      ****|       ****| |    |  | **** ..betaturn..            ****    ****|  ****      |  | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                |  |                  ..    |   |                     |  | ..                             |  ||  |       |   |     |  | |       | | ||||         | |             |  |            | |     | |        | |       |  |***    |  |      ..gammaturn..            |  |    | | |            |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..                |  |                  ..    |   |                     |  | ..                             |  ||  |       |   |     |  ***       *** ****         ***             |  |            ***     ***        ***       |  |       |  |      ..nest..            |  |    | | |            |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..                ****                  ..    |   |                     **** ..                             ********       |   |     |    |                                        ****                                         ****       ****      ..niche..            ****    | | |            **** 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                      ..    |   |                          ..                                            |   |     ******                                                                                                          ..schellmannloop..                    | | |                 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                      ..    |   |                          ..                                            *****                                                                                                                     ..stmotif..                    *****                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                      ..    *****                          ..                                                                                                                                                                      ..ststaple..                    | |                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                      ..                                   ..                                                                                                                                                                      ..stturn..                    ***                   

chain C : TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT ALPH
member of: CATH:search3.40.50.10470GENE3D:searchG3DSA_3.40.50.10470PANTHER:searchPTHR10233/searchPTHR10233_SF18PFAM:searchPF01008SUPERFAMILY:searchSSF100950UniProt:searchQ14232
JMol viewer RasMol script viewer  SO4 503C  ..                                                                                  ..                                             ***                                                                                                    *                   ..SO4 ..                                            
sec str:  ...hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh....eeeee..hhhhhhhhhhhhh.....eeeee.....hhhhhhhhhhhh....eeeehhhhhhhhhhhh.eeee...ee.....eeee.hhhhhhhhhhhh...eeee.hhhhh......hhhhhhhhhhh.... ....eee....eeeehhhhh.eeee..eeehhhhhhhhhhhhh...
sequence :  ..MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLE..YSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYK... ..QDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYLAA
seq num:  ..1         11        21        31        41        51        61        71          ..86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246     ... ..264       274       284       294       304 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  ||         |  |        |  |    |  |   |   ^***  | | ||   |   |  |   |  |     ..               || ||          |  ||  |                  | ||| ||    ||| ||||||    |  | |     |  |    |  |       ||   |||   | |||     || |||       | ||       |  || |||| ..PS00001.. |           || ||    | ||| |  |            
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  |  ||         |  |        |  |    |  |   |    | |  | | ||   |   |  |   |  |     ..               |**^*          |  ||  |                  | ||**^*    ||| ||||||    |  | |     |  |    |  |       ||   |||   | |||     || |||       | ||       |  || |||| ..PS00004.. |           || ||    | ||| |  |            
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  ||         |  |        |  |    |  |   |    | |  | | ||   |   |  |   |  |     ..               |   |          |  ||  |                  | |||       ||| ||^**|    |  | |     |  |    |  |       ||   |||   | |||     || |||       ^**|       |  || |||| ..PS00005.. |           || ||    | ||| |  |            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  ||         |  |        ^***    |  |   |    | ^*** | ||   |   ^***   |  |     ..               |   |          |  ||  |                  | |||       |^***||| |    |  | |     |  |    |  |       ||   |||   | |||     || |||       |  |       |  || |||| ..PS00006..**           || ||    | ||| |  |            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  ||         |  |                |  |   ^***** |  | | ^*****          |  |     ..               |   |          |  ||  |                  | |||       | | |||| |    |  | |     |  |    |  |       |^*****|   | |||     || |||       |  |       |  || |||| ..PS00008..             || ||    | ||| |  |            
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  |  ||         |  |                |  |          |  | |  |              |  |     ..               |   |          |  ||  |                  | |||       | | ||^***    |  | |     |  |    |  |       ||   | |   | |||     || |||       |  |       |  || |||| ..PS00009..             || ||    | ||| |  |            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  *****         |  |                |  |          |  | |  |              |  |     ..               |   |          |  ||  |                  | |||       | | ||||      |  | |     |  |    |  |       ||   | |   | |||     || |||       |  |       |  |*****| ..alphabetamotif..             || ||    | ||| |  |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |          |  |                |  |          |  | |  |              |  |     ..               |   |          |  ||  |                  | |||       | | ||||      |  | |     |  |    |  |       ||   ***   | |||     || |||       |  |       |  || || | ..asxturn..             || ||    | ||| |  |            
search RasMol script viewer Motif-ligand binding stats  betabulge ..  |  |          |  |                |  |          |  | |  |              |  |     ..               |   |          |  ||  |                  | |||       | | ||||      |  | |     |  |    |  |       **   | |   | |||     || |||       |  |       |  || || | ..betabulge..             || ||    | ||| |  |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****          |  |                |  |          **** ****              |  |     ..               |   |          ********                  ****|       | | ||||      **** |     ****    |  |            | |   ****|     |****|       |  |       |  |**** | ..betaturn..             *****    ****| ****            
search RasMol script viewer Motif-ligand binding stats  nest ..                |  |                |  |                                 |  |     ..               |   |          |  ||  |                    ***       *** ****         ***             |  |            ***     ***     |  ***       |  |       |  |  |  | ..nest..              |  |    | | |                 
search RasMol script viewer Motif-ligand binding stats  niche ..                ****                ****                                 ****     ..               |   |          ********                                                               ****                            |    |       ****       ****  **** ..niche..              ****    | | |                 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                  ..               |   |                                                                                                                 ******                             ..schellmannloop..                      | | |                 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                  ..               |   |                                                                                                                                                    ..stmotif..                      *****                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                  ..               *****                                                                                                                                                    ..ststaple..                      | |                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                  ..                                                                                                                                                                        ..stturn..                      ***                   

chain D : TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT ALPH
member of: CATH:search3.40.50.10470GENE3D:searchG3DSA_3.40.50.10470PANTHER:searchPTHR10233/searchPTHR10233_SF18PFAM:searchPF01008SUPERFAMILY:searchSSF100950UniProt:searchQ14232
JMol viewer RasMol script viewer  SO4 504D  ..                                       ..                                     ..                                             ***                                                                                                    *                     ..SO4 ..                                             
sec str:  ...hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh....hhhhhhhhh...........hhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhh......eeee...hhhhhhhhhhhhhh....eeeee.....hhhhhhhhhhhh....eeee...hhhhhhhhh.eeee...ee.....eeee.hhhhhhhhhhhh...eeee.hhhhh......hhhhhhhhhhh...... ....ee......eeeehhhhh.eeee..eeehhhhhhhhhhhhhhh.
sequence :  ..MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKG..IQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISL..YSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKAD... ..GQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYLAA
seq num:  ..1         11        21        31       ..42        52        62        72     ..86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       ... ..263       273       283       293       303  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                |  |        |  | |  |  ..  |   ^***  |   | | ||   |  |  ||  | ..  |  |          |||||      |  || ||  |       |   |     || ||| ||     |  ||||||    || |||     |  |    |  |       ||   |||   | |||      | |||       | ||      || ||  |  |   ..PS00001..  |            |  |    |  |             |  | 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..                |  |        |  | |  |  ..  |    | |  |   | | ||   |  |  ||  | ..  |  |          **^*|      |  || ||  |       |   |     || ||**^*     |  ||||||    || |||     |  |    |  |       ||   |||   | |||      | |||       | ||      || ||  |  |   ..PS00004..  |            |  |    |  |             |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                |  |        |  | |  |  ..  |    | |  |   | | ||   |  |  ||  | ..  |  |           |  |      |  || ||  |       |   |     || |||        |  ||^**|    || |||     |  |    |  |       ||   |||   | |||      | |||       ^**|      || ||  |  |   ..PS00005..  |            |  |    |  |             |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                |  |        ^*** |  |  ..  |    | ^***   | | ||   ^***  ||  | ..  |  |           |  |      |  || ||  |       |   |     || |||        ^***||| |    || |||     |  |    |  |       ||   |||   | |||      | |||       |  |      || ||  |  |   ..PS00006..***            |  |    |  |             |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                |  |             |  |  ..  ^*****        ^*****         ||  | ..  |  |           |  |      |  || ||  |       |   |     || |||           |||| |    || |||     |  |    |  |       |^*****|   | |||      | |||       |  |      || ||  |  |   ..PS00008..               |  |    |  |             |  | 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                |  |             |  |  ..                  | |          ||  | ..  |  |           |  |      |  || ||  |       |   |     || |||           ||^***    || |||     |  |    |  |       ||   | |   | |||      | |||       |  |      || ||  |  |   ..PS00009..               |  |    |  |             |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..                |  |             |  |  ..                  | |          ||  | ..  |  |           |  |      |  || ||  |       |   |     || |||           ||||      || |||     |  |    |  |       ||   ***   | |||      | |||       |  |      || ||  |  |   ..asxturn..               |  |    |  |             |  | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..                |  |             |  |  ..                  | |          ||  | ..  |  |           |  |      |  || ||  |       |   |     || |||           ||||      || |||     |  |    |  |       **   | |   | |||      | |||       |  |      || ||  |  |   ..betabulge..               |  |    |  |             |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                |  |             |  |  ..                  | |          ||  | ..  ****           ****      |  || |****       |   |     |****|           ||||      *****|     ****    ****            | |   ****|      ****|       ****      ****|  |  |   ..betaturn..               |  |    ****             |  | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                |  |             |  |  ..                  ***          ||  | ..  |  |                     |  || ||  |       |   |     |  | |           ||||         | |             |  |            | |     | |        | |       |  |       |  |  |  |   ..gammaturn..               |  |                     |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..                |  |             |  |  ..                               ||  | ..  |  |                     |  || ||  |       |   |     |  ***           ****         ***             |  |            ***     ***        ***       |  |       |  |  |  |   ..nest..               |  |                     |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..                ****             ****  ..                               |**** ..  ****                     |  ********       |   |     |    |                                        ****                                         ****       ****  ****   ..niche..               ****                     **** 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                       ..                               |   | ..                           |   |             |   |     ******                                                                                                             ..schellmannloop..                                             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                       ..                               |   | ..                           |   |             *****                                                                                                                        ..stmotif..                                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                       ..                               ***** ..                           *****                                                                                                                                          ..ststaple..                                             

chain E : TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT ALPH
member of: CATH:search3.40.50.10470GENE3D:searchG3DSA_3.40.50.10470PANTHER:searchPTHR10233/searchPTHR10233_SF18PFAM:searchPF01008SUPERFAMILY:searchSSF100950UniProt:searchQ14232
JMol viewer RasMol script viewer  SO4 505E  ..                                     ..                                       ..                                            ***                                                                                                    *                  ..SO4 ..                                           
sec str:  ...hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.....hhhhhhhhh...........hhhhhhhhhhhhhhh........hhhhhhhhhhhhhh.hhhhhhhhhh........eeeee..hhhhhhhhhhhhh.....eeeee.....hhhhhhhhhhhh....eeeehhhhhhhhhhhh.eeee...ee.....eeee.hhhhhhhhhhhh...eeee.hhhhh......hhhhhhhhhhh... ...eeee...eeeehhhhh.eeee..eeehhhhhhhhhhhhhh..
sequence :  ..MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRD..ETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISL..SKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKY... ..DLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYLAA
seq num:  ..1         11        21        31     ..40        50        60        70       ..87        97        107       117       127       137       147       157       167       177       187       197       207       217       227       237       247   ... ..265       275       285       295          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                |  |    |   |  |     ..    | ||^***  |   | | ||   |  |  |   | ..               | ||     |  | |  ||  |                 || ||| ||    ||| ||||||    || |||     |  |   || ||       || | |||   | |||      | |||       | ||      || ||      ..PS00001..|            |  |          |  |            
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..                |  |    |   |  |     ..    | || |||  |   | | ||   |  |  |   | ..               **^*     |  | |  ||  |                 || ||**^*    ||| ||||||    || |||     |  |   || ||       || | |||   | |||      | |||       | ||      || ||      ..PS00004..|            |  |          |  |            
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                |  |    |   |  |     ..    | || |||  |   | | ||   |  |  |   | ..                        |  | |  ||  |                 || |||       ||| ||^**|    || |||     |  |   || ||       || | |||   | |||      | |||       ^**|      || ||      ..PS00005..|            |  |          |  |            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                |  |    |   ^***     ..    | || ||^***   | | ||   ^***  |   | ..                        |  | |  ||  |                 || |||       |^***||| |    || |||     |  |   || ||       || | |||   | |||      | |||       |  |      || ||      ..PS00006..*            |  |          |  |            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                |  |    |   |        ..    ^*****||      ^*****   |     |   | ..                        |  | |  ||  |                 || |||       | | |||| |    || |||     |  |   || ||       |^*****|   | |||      | |||       |  |      || ||      ..PS00008..             |  |          |  |            
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                |  |    |   |        ..      ||  ||        | ||   |     |   | ..                        |  | |  ||  |                 || |||       | | ||^***    || |||     |  |   || ||       || | |||   | |||      | |||       |  |      || ||      ..PS00009..             |  |          |  |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..                |  |    |   |        ..      ||  ||        | ||   |     |   | ..                        |  | |  ||  |                 || |||       | | ||||      || |||     |  |   || ||       || | ***   | |||      | |||       |  |      || ||      ..asxturn..             |  |          |  |            
search RasMol script viewer Motif-ligand binding stats  betabulge ..                |  |    |   |        ..      ||  ||        | ||   |     |   | ..                        |  | |  ||  |                 || |||       | | ||||      || |||     |  |   || ||       ** | |||   | |||      | |||       |  |      || ||      ..betabulge..             |  |          |  |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ****    |   |        ..      ||  ||        | ||   |     |   | ..                        **** |  |****                 |****|       | | ||||      |****|     ****   *****          ****|   ****|      ****|       |  |      ****|      ..betaturn..             ****          ****            
search RasMol script viewer Motif-ligand binding stats  nest ..                |  |    |   |        ..      ||  ||        ***|   |     |   | ..                             |  ||  |                 |  ***       *** ****      |  ***             |  |            ***     ***        ***       |  |       |  |      ..nest..             |  |                          
search RasMol script viewer Motif-ligand binding stats  niche ..                ****    |   |        ..      ||  ||           |   |     |   | ..                             ********                 |    |                     |    |             ****                                         ****       ****      ..niche..             ****                          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                        |   |        ..      ||  ||           |   |     |   | ..                                                      ******                     ******                                                                               ..schellmannloop..                                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                        *****        ..      ******           *****     ***** ..                                                                                                                                                                      ..ststaple..                                           

chain F : TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT ALPH
member of: CATH:search3.40.50.10470GENE3D:searchG3DSA_3.40.50.10470PANTHER:searchPTHR10233/searchPTHR10233_SF18PFAM:searchPF01008SUPERFAMILY:searchSSF100950UniProt:searchQ14232
JMol viewer RasMol script viewer  SO4 510F  ..                                                                             ..                                **                        *                                                                                                            ..SO4 ..                                           
JMol viewer RasMol script viewer  SO4 506F  ..                                                                             ..                                ||         ***            |                                                                                       *                    ..SO4 ..                                           
JMol viewer RasMol script viewer  SO4 509A  ..                                                                             ..                      *         ||         |||            |                                                                                       |                    ..SO4 ..                                           
sec str:  ...hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeee..hhhhhhhhhhhhhh....eeeee.....hhhhhhhhhhhh....eeeehhhhhhhhhhhh.eeee...eee....eeee.hhhhhhhhhhhh...eeee.hhh.ee.....hhhhh........... ...ee....eeeehhhhh.eeee..eeehhhhhhhhhhhhhh...
sequence :  ..MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFIS..KCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKA... ..LKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYLAAA
seq num:  ..1         11        21        31        41        51        61        71     ..88        98        108       118       128       138       148       158       168       178       188       198       208       218       228       238       248    ... ..266       276       286       296          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                |  |        |  | |  |      |  |^***| || || | ||   |  |  |  | ..    |  ||     | ||         || |||  |       |   |     || ||| ||     |  ||||||    |  | |     |  |    |  |       ||   |||   | |||        | |       | ||       |  | |  ||| ..PS00001..           || ||    |  |                   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..                |  |        |  | |  |      |  ||| || || || | ||   |  |  |  | ..    |  ||     **^*         || |||  |       |   |     || ||**^*     |  ||||||    |  | |     |  |    |  |       ||   |||   | |||        | |       | ||       |  | |  ||| ..PS00004..           || ||    |  |                   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                |  |        |  | |  |      |  ||| || || || | ||   |  |  |  | ..    |  ||                  || |||  |       |   |     || |||        |  ||^**|    |  | |     |  |    |  |       ||   |||   | |||        | |       ^**|       |  | |  ||| ..PS00005..           || ||    |  |                   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                |  |        ^*** |  |      |  ||| ^***| || | ||   ^***  |  | ..    |  ||                  || |||  |       |   |     || |||        ^***|||||    |  | |     |  |    |  |       ||   |||   | |||        | |       |  |       |  | |  ||| ..PS00006..           || ||    |  |                   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                |  |             |  |      ^***** ||  | |^*****   |     |  | ..    |  ||                  || |||  |       |   |     || |||           ||||||    |  | |     |  |    |  |       |^*****|   | |||        | |       |  |       |  | |  ||| ..PS00008..           || ||    |  |                   
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                |  |             |  |         ||  ||  | || | ||   |     |  | ..    |  ||                  || |||  |       |   |     || |||           ||^***    |  | |     |  |    |  |       ||   | |   | |||        | |       |  |       |  | |  ||| ..PS00009..           || ||    |  |                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                |  |             |  |         |*****  | || | ||   |     |  | ..    *****                  || |||  |       |   |     || |||           |*****    |  | |     |  |    |  |       ||   | |   | |||        | |       |  |       |  | *****| ..alphabetamotif..           || ||    |  |                   
search RasMol script viewer Motif-ligand binding stats  asxturn ..                |  |             |  |         ||  |   | || ***|   |     |  | ..    |  |                   || |||  |       |   |     || |||           |||||     |  | |     |  |    |  |       ||   ***   | |||        | |       |  |       |  | |  | | ..asxturn..           || ||    |  |                   
search RasMol script viewer Motif-ligand binding stats  betabulge ..                |  |             |  |         ||  |   | || |  |   |     |  | ..    |  |                   || |||  |       |   |     || |||           |||||     |  | |     |  |    |  |       **   | |   | |||        | |       |  |       |  | |  | | ..betabulge..           || ||    |  |                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                |  |             ****         |****   ******  |   |     |  | ..    ****                   ****||  |       |   |     |****|           |****     **** |     ****    |  |            | |   ****|        | |       ****       |  | **** | ..betaturn..           *****    ****                   
search RasMol script viewer Motif-ligand binding stats  nest ..                |  |                          |   |           |   |     |  | ..                            |  ||  |       |   |     |  ***           ****         ***             |  |            ***     ***        ***       |  |       |  |    *** ..nest..            |  |                           
search RasMol script viewer Motif-ligand binding stats  niche ..                ****                          |   |           |   |     **** ..                            ********       |   |     |    |                                        ****                                         ****       ****        ..niche..            ****                           
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                              |   |           |   |          ..                                           |   |     ******                                                                                                            ..schellmannloop..                                           
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                              |   |           |   |          ..                                           *****                                                                                                                       ..stmotif..                                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                              *****           *****          ..                                                                                                                                                                       ..ststaple..                                           

chain G : TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT ALPH
member of: CATH:search3.40.50.10470GENE3D:searchG3DSA_3.40.50.10470PANTHER:searchPTHR10233/searchPTHR10233_SF18PFAM:searchPF01008SUPERFAMILY:searchSSF100950UniProt:searchQ14232
JMol viewer RasMol script viewer  SO4 507G  ..                                        ..                                     ..                    *                      ***                                                                                                    *                  ..SO4 ..                                          
sec str:  ...hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.....hhhhhhhhhh..hhhhhh.hhhhhhhhhhhhhh..........hhhhhhhhhhhhh.hhhhhhhhhhh.......eeeee..hhhhhhhhhhhhh.....eeeee.....hhhhhhhhhhhh....eeeehhhhhhhhhhhh.eeeee..ee.....eeee.hhhhhhhhhhhh...eeee.hhhhh......hhhhhhhhhhh... ...ee....eeeehhhhh.eeee..eeehhhhhhhhhhhhhh..
sequence :  ..MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGE..QGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLA..KCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKY... ..LKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYLAA
seq num:  ..1         11        21        31        ..43        53        63        73     ..88        98        108       118       128       138       148       158       168       178       188       198       208       218       228       238       248  ... ..266       276       286       296         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                 | |        |  | || |   ..|| ||^***  ||| ||| |||  |  |    | |||..     |  ||   || ||          |  ||  |                 || ||| ||    ||| |||||| |  || |||     |  |    |  |       || | |||   | |||     || |||       | ||       |  |      ..PS00001..            |  |    |  |  |  |            
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..                 | |        |  | || |   ..|| || | |  ||| ||| |||  |  |    | |||..     |  ||   |**^*          |  ||  |                 || ||**^*    ||| |||||| |  || |||     |  |    |  |       || | |||   | |||     || |||       | ||       |  |      ..PS00004..            |  |    |  |  |  |            
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                 | |        |  | || |   ..|| || | |  ||| ||| |||  |  |    | |||..     |  ||   |   |          |  ||  |                 || |||       ||| ||^**| |  || |||     |  |    |  |       || | |||   | |||     || |||       ^**|       |  |      ..PS00005..            |  |    |  |  |  |            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                 | |        ^*** || |   ..|| || | ^***|| ||| |||  ^***    | |||..     |  ||   |   |          |  ||  |                 || |||       |^***||| | |  || |||     |  |    |  |       || | |||   | |||     || |||       |  |       |  |      ..PS00006..            |  |    |  |  |  |            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                 | |             || |   ..|^***** |   || ^*****|          | |||..     |  ||   |   |          |  ||  |                 || |||       | | |||| | |  || |||     |  |    |  |       |^*****|   | |||     || |||       |  |       |  |      ..PS00008..            |  |    |  |  |  |            
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                 | |             || |   ..|  ||   |   || ||| | |          | |||..     |  ||   |   |          |  ||  |                 || |||       | | ||^*** |  || |||     |  |    |  |       || | |||   | |||     || |||       |  |       |  |      ..PS00009..            |  |    |  |  |  |            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 | |             || |   ..|  ||   |   || ||| | |          | |||..     *****   |   |          |  ||  |                 || |||       | | ||||   ***** |||     |  |    |  |       || | |||   | |||     || |||       |  |       |  |      ..alphabetamotif..            |  |    |  |  |  |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..                 | |             || |   ..|  ||   |   || ||| | |          | |||..     |  |    |   |          |  ||  |                 || |||       | | ***|   |  || |||     |  |    |  |       || | |||   | |||     || |||       |  |       |  |      ..asxturn..            |  |    |  |  |  |            
search RasMol script viewer Motif-ligand binding stats  betabulge ..                 | |             || |   ..|  ||   |   || ||| | |          | |||..     |  |    |   |          |  ||  |                 || |||       | | ||||   |  || |||     |  |    |  |       ** | |||   | |||     || |||       |  |       |  |      ..betabulge..            |  |    |  |  |  |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 | |             ****   ..****|   |   *****| | |          | |||..     ****    |   |          |  |****                 |****|       | | ||||   ********|     ****    |  |          ****|   ****|     |****|       ****       |  |      ..betaturn..            ****    ****  ****            
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                 | |              | |   ..    |   |      | | | |          | ***..             |   |          |  ||  |                 |  | |       | | ||||      |  | |             |  |            | |     | |     |  | |       |  |       |  |      ..gammaturn..            |  |                          
search RasMol script viewer Motif-ligand binding stats  nest ..                 | |              | |   ..    |   |      | | | |          |  | ..             |   |          |  ||  |                 |  ***       *** ****      |  ***             |  |            ***     ***     |  ***       |  |       |  |      ..nest..            |  |                          
search RasMol script viewer Motif-ligand binding stats  niche ..                 ***              ***   ..    |   |      ***** |          **** ..             |   |          ********                 |    |                     |    |             ****                            |    |       ****       ****      ..niche..            ****                          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                        ..    |   |          | |               ..             |   |                                   ******                     ******                                             ******                            ..schellmannloop..                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                        ..    *****          | |               ..             *****                                                                                                                                                   ..ststaple..                                          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                        ..                   ***               ..                                                                                                                                                                     ..stturn..                                          

chain H : TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT ALPH
member of: CATH:search3.40.50.10470GENE3D:searchG3DSA_3.40.50.10470PANTHER:searchPTHR10233/searchPTHR10233_SF18PFAM:searchPF01008SUPERFAMILY:searchSSF100950UniProt:searchQ14232
JMol viewer RasMol script viewer  SO4 508H  ..                                                                              ..                                            ***                                                                                                    *                   ..SO4 ..                                        
sec str:  ...hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh.......hhhhhh...........hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh....eeeee..hhhhhhhhhhhhhh....eeeee.....hhhhhhhhhhhh....eeeehhhhhhhhhhhh.eeeee..ee.....eeee.hhhhhhhhhhhh...eeee.hhhhh......hhhhhhhhhhh.... .......eeeehhhhh.eeee..eeehhhhhhhhhhhhhh..
sequence :  ..MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISL..SKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYK... ..EEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYLAA
seq num:  ..1         11        21        31        41        51        61        71      ..87        97        107       117       127       137       147       157       167       177       187       197       207       217       227       237       247    ... ..268       278       288       298       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |   |    |  || |  ||  ||   | || || |   | ||  |^***| || || |  |  ||  |  ||  | ..              || ||              |  |       |   |     || ||| ||    ||| ||||||    || |||     |  |    |  |       ||   |||   | |||     || |||       | ||| |    |  | || || ..PS00001..         || ||    | |||            |  | 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |   |    |  || |  ||  ||   | || || |   | ||  ||| || || || |  |  ||  |  ||  | ..              |**^*              |  |       |   |     || ||**^*    ||| ||||||    || |||     |  |    |  |       ||   |||   | |||     || |||       | ||| |    |  | || || ..PS00004..         || ||    | |||            |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |   |    |  || |  ||  ||   | || || |   | ||  ||| || || || |  |  ||  |  ||  | ..              |   |              |  |       |   |     || |||       ||| ||^**|    || |||     |  |    |  |       ||   |||   | |||     || |||       ^**|| |    |  | || || ..PS00005..         || ||    | |||            |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |   |    |  || |  ||  ||   ^*** || |   | ||  ||| ^***| || |  |  |^***  ||  | ..              |   |              |  |       |   |     || |||       |^***||| |    || |||     |  |    |  |       ||   |||   | |||     || |||       |  || |    |  | || || ..PS00006..         || ||    | |||            |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |   |    |  || |  ||  ||     |  || |   | |^***** || || |^*****  ||     ||  | ..              |   |              |  |       |   |     || |||       | | |||| |    || |||     |  |    |  |       |^*****|   | |||     || |||       |  || |    |  | || || ..PS00008..         || ||    | |||            |  | 
search RasMol script viewer Motif-ligand binding stats  AMIDATION .. |   |    |  || |  ||  ||     |  || |   | |   ||  || || || |  |  ||     ||  | ..              |   |              |  |       |   |     || |||       | | ||^***    || |||     |  |    |  |       ||   | |   | |||     || |||       |  || |    |  | || || ..PS00009..         || ||    | |||            |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |   |    ***** |  |*****     ***** |   | |   |***** || || |  *****     ||  | ..              |   |              |  |       |   |     || |||       | | ||||      || |||     |  |    |  |       ||   | |   | |||     || |||       |  || |    |  | ***** ..alphabetamotif..         || ||    | |||            |  | 
search RasMol script viewer Motif-ligand binding stats  asxmotif .. *****    |  |  |  ||  |      |  || |   | |   ||  |  || || |  |  |      ||  | ..              |   |              |  |       |   |     || |||       | | ||||      || |||     |  |    |  |       ||   | |   | |||     || |||       |  || |    |  | || || ..asxmotif..         || ||    | |||            |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  |  |  ||  |      |  || |   | |   ||  |  || || |  |  |      ||  | ..              |   |              |  |       |   |     || |||       | | ||||      || |||     |  |    |  |       ||   ***   | |||     || |||       |  || |    |  | || || ..asxturn..         || ||    | |||            |  | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..          |  |  |  ||  |      |  || |   | |   ||  |  || || |  |  |      ||  | ..              |   |              |  |       |   |     || |||       | | ||||      || |||     |  |    |  |       **   | |   | |||     || |||       |  || |    |  | || || ..betabulge..         || ||    | |||            |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ****  ********      ****| |   | |   |*********** |  ****      ||  | ..              |   |              |  |       |   |     |****|       | | ||||      |****|     ****    ****            | |   ****|     |****|       |  || |    |  | ****| ..betaturn..         *****    ****|            **** 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                |  |              | |   | |   |   |     |  |            ||  | ..              |   |              |  |       |   |     |  | |       | | ||||      |  | |             |  |            | |     | |     |  | |       |  |***    |  |  |  | ..gammaturn..          |  |    | | |                 
search RasMol script viewer Motif-ligand binding stats  nest ..                |  |              | |   ***   |   |     |  |            ||  | ..              |   |              |  |       |   |     |  ***       *** ****      |  ***             |  |            ***     ***     |  ***       |  |       |  |  |  | ..nest..          |  |    | | |                 
search RasMol script viewer Motif-ligand binding stats  niche ..                ****              ***         |   |     ****            |**** ..              |   |              ****       |   |     |    |                     |    |             ****                            |    |       ****       ****  **** ..niche..          ****    | | |                 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                              |   |                     |   | ..              |   |                         |   |     ******                     ******                                             ******                             ..schellmannloop..                  | | |                 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                              |   |                     |   | ..              |   |                         *****                                                                                                                      ..stmotif..                  *****                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                              *****                     ***** ..              *****                                                                                                                                                    ..ststaple..                  | |                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                              ..                                                                                                                                                                       ..stturn..                  ***                   

   New search    3ecs:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors