triangle PDBeMotif: 3dyq  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.4.35
Classification hydrolase    | release date: Mon, Jul 28, 2008
Title human phosphodiestrase 9 (inhibited by omitting divalent cat complex with cgmp
Authors D.DANLEY, F.MENNITI, J.PEREZ, K.DILLMAN, M.N.MANSOUR, S.LIU
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Small molecules:    search PCG PCG binding statistics PCG   search IBM IBM binding statistics IBM   search NA NA binding statistics NA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GSHMTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHC
FCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPE
CNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWV
DCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRID
DAMKELQKK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HIGH AFFINITY CGMP-SPECIFIC 3',5'-CYCLIC PHOSPHOD9A;
member of: CATH:search1.10.1300.10GENE3D:searchG3DSA_1.10.1300.10PANTHER:searchPTHR11347/searchPTHR11347_SF103PFAM:searchPF00233PRINTS:searchPDIESTERASE1PROSITE PATTERNS:searchPS00126, SMART:searchSM00471SUPERFAMILY:searchSSF109604UniProt:searchO76083
JMol viewer RasMol script viewer  PCG 900A  ..                                                                          *                                                                                                                *                                    **                *   *                           **  *                                                 
JMol viewer RasMol script viewer  NA 902A  ..                                                                          |                                        *                                                                       |                                    ||                |   |                           ||  |                                                 
JMol viewer RasMol script viewer  NA 901A  ..                                                                          |   *                                   **                                                                       |                                    *|                |   |                           ||  |                                                 
sec str:  .............hhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....
sequence :  ..GSHMTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAMKELQK
seq num:  ..178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    ||  |       | ||||| |  |  |   |  |     ||||  | |   | |     || ||| | | |        |   | || ||||||||  |||   |   |||| |   ^***   | |   | | | |  |         |  |  || |  |              | || ||  |     | ||     |||| |               || ||                   | ||  | |  || ||||||                 |   |  |                          || ||  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    ||  |       | **^*| |  |  |   |  |     ||||  | |   | |     || ||| | | |        |   | || ||||||||  |||   |   |||| |      |   | |   | | | |  |         |  |  || |  |              | || ||  |     | ||     |||| |               || ||                   | ||  | |  || ||||||                 |   |  |                          || ||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    ||  |       |  |  | |  |  |   |  |     ||||  | |   ^**     || ||| | | |        |   | || ||||||||  |||   |   |||| |      |   | |   | | | |  |         |  |  || |  |              | || ||  |     ^**|     |||| |               || ||                   ^**|  | |  || ||||||                 |   |  |                          || ||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ||  |       |  |  | |  |  |   ^***     ||||  | |           || ||| | | |        |   | || |^***||^***||   |   |||| |      |   | |   | | | ^***         |  |  || |  |              | || ||  |     ^***     ||^***               || ||                   ^***  | |  || ||||||                 |   |  |                          || ||  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|    ||  |       |  |  | |  |  |   |        ||||  | |           || ||| | | |        |   | || |||| |||   ||   |   |||| |      |   | |   | | |              |  |  || |  |              | || ||  |       ********^||                 || ||                         | |  || ||||||                 |   |  |                          || ||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****|  |       |  |  | |  |  |   |        ||||  | |           || ||| | | |        |   | || |||| |||   ||   |   |||| |      |   | |   | | |              |  |  || |  |              | || ||  |              | ||                 || ||                         | |  || ||||||                 |   |  |                          || ||  
search RasMol script viewer Motif-ligand binding stats  PDEASE_I ..      |  |       |  |  | |  |  |   |        ||||  | |           || ||| | | |        |   | || |||| |||   ||   |   |************   | |   | | |              |  |  || |  |              | || ||  |              | ||                 || ||                         | |  || ||||||                 |   |  |                          || ||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      |  |       |  |  | |  |  |   |        ||||  | |           *****| | | |        |   | || ||*****|   ||   |   | || |          | |   | | |              |  |  || |  |              | || ||  |              | ||                 || ||                         | |  || ||||||                 |   |  |                          *****  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..      |  |       |  |  | |  |  |   |        ||||  | |           || ||| | | |        |   | || |||| |||   ||   |   | || |          | |   | | |              |  |  || |  |              | || ||  |              | ||                 || ||                         | |  || |*****                 |   |  |                          || ||  
search RasMol script viewer Motif-ligand binding stats  asxturn ..      |  |       |  |  | |  |  |   |        ||||  | |           || ||| | | |        |   | || |||| |||   ||   |   | || |          | |   | | |              |  |  |***  |              | || ||  |              ***|                 || ||                         | |  || |***||                 |   |  |                          || ||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****       |  |  | |  |  |   |        ||||  | |           ****|| | | |        |   | |********||   ||   |   | || |          | |   | | |              |  ****  ****              **** |****              |  |                 ****|                         | |  ********|                 |   |  |                          ****|  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      |  |       |  |  | |  |  |   |        ||||  | |            |  |*** ***        |   | |  ||||  ||   ||   |   | || |          | |   | | |              |  |     |  |                |  |                  |  |                  |  |                         | |   |  ||  |                 |   |  |                           |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |       |  |  | |  |  |   |        ****  ***            |  |               |   | |  ****  ||   ||   |   | || |          ***   | ***              |  |     |  |                |  |                  |  |                  |  |                         ***   |  ||  |                 |   |  |                           |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..      ****       ******* ****  |   |                             ****               |   | |    |****|   ||   |   ******            |   |                  ****     ****                ****                  ****                  ****                               ********                 |   ****                           ****  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                               |   |                                                |   | ******    |   ||   |                     |   |                                                                                                                                                       |   |                                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                               |   |                                                |   |           *****|   |                     *****                                                                                                                                                       |   |                                    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                               *****                                                *****                *****                                                                                                                                                                                 *****                                    

chain B : HIGH AFFINITY CGMP-SPECIFIC 3',5'-CYCLIC PHOSPHOD9A;
member of: CATH:search1.10.1300.10GENE3D:searchG3DSA_1.10.1300.10PANTHER:searchPTHR11347/searchPTHR11347_SF103PFAM:searchPF00233PRINTS:searchPDIESTERASE1PROSITE PATTERNS:searchPS00126, SMART:searchSM00471SUPERFAMILY:searchSSF109604UniProt:searchO76083
JMol viewer RasMol script viewer  IBM 900B  ..                                                                                                                                                                                           *                                     *                *   *                *          **  *                                                 
JMol viewer RasMol script viewer  NA 902B  ..                                                                                                                   *                                                                       |                                     |                |   |                |          ||  |                                                 
JMol viewer RasMol script viewer  NA 901B  ..                                                                                                                  **                                                                       |                                    *|                |   |                |          ||  |                                                 
sec str:  .............hhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhh.hhhhhhh...hhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..GSHMTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAMKELQK
seq num:  ..178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    ||  |       | |||||||| |      |  |     ||||  | |   | |      |  |    | |   |          || ||||||||  |||   |   |||| |   ^***|  | |     | | |  |         |  |  |  |  |                |  | |       | ||     |||| |               || ||               |   | ||  | |  || ||||||                        |  |                        |  || 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    ||  |       | **^*|||| |      |  |     ||||  | |   | |      |  |    | |   |          || ||||||||  |||   |   |||| |   |  ||  | |     | | |  |         |  |  |  |  |                |  | |       | ||     |||| |               || ||               |   | ||  | |  || ||||||                        |  |                        |  || 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    ||  |       |  |  |||| |      |  |     ||||  | |   ^**      |  |    | |   |          || ||||||||  |||   |   |||| |   |  ||  | |     | | |  |         |  |  |  |  |                |  | |       ^**|     |||| |               || ||               |   ^**|  | |  || ||||||                        |  |                        |  || 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ||  |       |  |  |||| |      ^***     ||||  | |            |  |    | |   |          || |^***||^***||   |   |||| |   |  ||  | |     | | ^***         |  |  |  |  |                |  | |       ^***     ||^***               || ||               |   ^***  | |  || ||||||                        |  |                        |  || 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|    ||  |       |  |  |||| |               ||||  | |            |  |    | |   |          || |||| |||   ||   |   |||| |   |  ||  | |     | |              |  |  |  |  |                |  | |         ********^|| |               || ||               |   |     | |  || ||||||                        |  |                        |  || 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****|  |       |  |  |||| |               ||||  | |            |  |    | |   |          || |||| |||   ||   |   |||| |   |  ||  | |     | |              |  |  |  |  |                |  | |                | || |               || ||               |   |     | |  || ||||||                        |  |                        |  || 
search RasMol script viewer Motif-ligand binding stats  PDEASE_I ..      |  |       |  |  |||| |               ||||  | |            |  |    | |   |          || |||| |||   ||   |   |************|  | |     | |              |  |  |  |  |                |  | |                | || |               || ||               |   |     | |  || ||||||                        |  |                        |  || 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      |  |       |  |  |||| |               ||||  | |            |  |    | |   |          || ||*****|   ||   |   | || |   |   |  | |     | |              |  |  |  |  |                |  | |                | || |               || ||               |   |     | |  *********                        |  |                        ***** 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..      |  |       |  |  |||| |               ||||  | |            |  |    | *****          || |||| |||   ||   |   | || |   *****  | |     | |              |  |  |  |  |                |  | |                | || |               || ||               |   |     | |  || |*****                        |  |                        |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..      |  |       |  |  |*** |               ||||  | |            |  |    | |              || |||| |||   ||   |   | || |          | |     | |              |  |  |  |  |                |  ***                ******               || ||               |   |     | |  || |***||                        |  |                        |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |  |       |  |  | |  |               ||||  | |            |  |    | |              |********||   ||   |   | || |          | |     | |              *******  ****                |  |                  |  |                 ****|               |   |     | |  ********|                        ****                        ****  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      |  |       |  |  | |  |               ||||  | |            |  |    ***              |  ||||  ||   ||   |   | || |          | |     | |              |  |     |  |                |  |                  |  |                  |  |               |   |     | |   |  ||  |                                                          
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |       |  |  | |  |               ****  ***            |  |                     |  ****  ||   ||   |   | || |          ***     ***              |  |     |  |                |  |                  |  |                  |  |               |   |     ***   |  ||  |                                                          
search RasMol script viewer Motif-ligand binding stats  niche ..      ****       ******* ****                                    ****                     |    |****|   ||   |   ******                                   ****     ****                ****                  ****                  ****               |   |           ********                                                          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                          ******    |   ||   |                                                                                                                                        |   |                                                                             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                    *****|   |                                                                                                                                        |   |                                                                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                         *****                                                                                                                                        *****                                                                             

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HIGH AFFINITY CGMP-SPECIFIC 3',5'-CYCLIC PHOSPHOD9A;
member of: CATH:search1.10.1300.10GENE3D:searchG3DSA_1.10.1300.10PANTHER:searchPTHR11347/searchPTHR11347_SF103PFAM:searchPF00233PRINTS:searchPDIESTERASE1PROSITE PATTERNS:searchPS00126, SMART:searchSM00471SUPERFAMILY:searchSSF109604UniProt:searchO76083
JMol viewer RasMol script viewer  PCG 900A  ..                                                                          *                                                                                                                *                                    **                *   *                           **  *                                                 
JMol viewer RasMol script viewer  NA 902A  ..                                                                          |                                        *                                                                       |                                    ||                |   |                           ||  |                                                 
JMol viewer RasMol script viewer  NA 901A  ..                                                                          |   *                                   **                                                                       |                                    *|                |   |                           ||  |                                                 
sec str:  .............hhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....
sequence :  ..GSHMTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAMKELQK
seq num:  ..178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    ||  |       | ||||| |  |  |   |  |     ||||  | |   | |     || ||| | | |        |   | || ||||||||  |||   |   |||| |   ^***   | |   | | | |  |         |  |  || |  |              | || ||  |     | ||     |||| |               || ||                   | ||  | |  || ||||||                 |   |  |                          || ||  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    ||  |       | **^*| |  |  |   |  |     ||||  | |   | |     || ||| | | |        |   | || ||||||||  |||   |   |||| |      |   | |   | | | |  |         |  |  || |  |              | || ||  |     | ||     |||| |               || ||                   | ||  | |  || ||||||                 |   |  |                          || ||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    ||  |       |  |  | |  |  |   |  |     ||||  | |   ^**     || ||| | | |        |   | || ||||||||  |||   |   |||| |      |   | |   | | | |  |         |  |  || |  |              | || ||  |     ^**|     |||| |               || ||                   ^**|  | |  || ||||||                 |   |  |                          || ||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ||  |       |  |  | |  |  |   ^***     ||||  | |           || ||| | | |        |   | || |^***||^***||   |   |||| |      |   | |   | | | ^***         |  |  || |  |              | || ||  |     ^***     ||^***               || ||                   ^***  | |  || ||||||                 |   |  |                          || ||  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|    ||  |       |  |  | |  |  |   |        ||||  | |           || ||| | | |        |   | || |||| |||   ||   |   |||| |      |   | |   | | |              |  |  || |  |              | || ||  |       ********^||                 || ||                         | |  || ||||||                 |   |  |                          || ||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****|  |       |  |  | |  |  |   |        ||||  | |           || ||| | | |        |   | || |||| |||   ||   |   |||| |      |   | |   | | |              |  |  || |  |              | || ||  |              | ||                 || ||                         | |  || ||||||                 |   |  |                          || ||  
search RasMol script viewer Motif-ligand binding stats  PDEASE_I ..      |  |       |  |  | |  |  |   |        ||||  | |           || ||| | | |        |   | || |||| |||   ||   |   |************   | |   | | |              |  |  || |  |              | || ||  |              | ||                 || ||                         | |  || ||||||                 |   |  |                          || ||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      |  |       |  |  | |  |  |   |        ||||  | |           *****| | | |        |   | || ||*****|   ||   |   | || |          | |   | | |              |  |  || |  |              | || ||  |              | ||                 || ||                         | |  || ||||||                 |   |  |                          *****  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..      |  |       |  |  | |  |  |   |        ||||  | |           || ||| | | |        |   | || |||| |||   ||   |   | || |          | |   | | |              |  |  || |  |              | || ||  |              | ||                 || ||                         | |  || |*****                 |   |  |                          || ||  
search RasMol script viewer Motif-ligand binding stats  asxturn ..      |  |       |  |  | |  |  |   |        ||||  | |           || ||| | | |        |   | || |||| |||   ||   |   | || |          | |   | | |              |  |  |***  |              | || ||  |              ***|                 || ||                         | |  || |***||                 |   |  |                          || ||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****       |  |  | |  |  |   |        ||||  | |           ****|| | | |        |   | |********||   ||   |   | || |          | |   | | |              |  ****  ****              **** |****              |  |                 ****|                         | |  ********|                 |   |  |                          ****|  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      |  |       |  |  | |  |  |   |        ||||  | |            |  |*** ***        |   | |  ||||  ||   ||   |   | || |          | |   | | |              |  |     |  |                |  |                  |  |                  |  |                         | |   |  ||  |                 |   |  |                           |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |       |  |  | |  |  |   |        ****  ***            |  |               |   | |  ****  ||   ||   |   | || |          ***   | ***              |  |     |  |                |  |                  |  |                  |  |                         ***   |  ||  |                 |   |  |                           |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..      ****       ******* ****  |   |                             ****               |   | |    |****|   ||   |   ******            |   |                  ****     ****                ****                  ****                  ****                               ********                 |   ****                           ****  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                               |   |                                                |   | ******    |   ||   |                     |   |                                                                                                                                                       |   |                                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                               |   |                                                |   |           *****|   |                     *****                                                                                                                                                       |   |                                    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                               *****                                                *****                *****                                                                                                                                                                                 *****                                    

chain B : HIGH AFFINITY CGMP-SPECIFIC 3',5'-CYCLIC PHOSPHOD9A;
member of: CATH:search1.10.1300.10GENE3D:searchG3DSA_1.10.1300.10PANTHER:searchPTHR11347/searchPTHR11347_SF103PFAM:searchPF00233PRINTS:searchPDIESTERASE1PROSITE PATTERNS:searchPS00126, SMART:searchSM00471SUPERFAMILY:searchSSF109604UniProt:searchO76083
JMol viewer RasMol script viewer  IBM 900B  ..                                                                                                                                                                                           *                                     *                *   *                *          **  *                                                 
JMol viewer RasMol script viewer  NA 902B  ..                                                                                                                   *                                                                       |                                     |                |   |                |          ||  |                                                 
JMol viewer RasMol script viewer  NA 901B  ..                                                                                                                  **                                                                       |                                    *|                |   |                |          ||  |                                                 
sec str:  .............hhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhh.hhhhhhh...hhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..GSHMTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAMKELQK
seq num:  ..178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    ||  |       | |||||||| |      |  |     ||||  | |   | |      |  |    | |   |          || ||||||||  |||   |   |||| |   ^***|  | |     | | |  |         |  |  |  |  |                |  | |       | ||     |||| |               || ||               |   | ||  | |  || ||||||                        |  |                        |  || 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|    ||  |       | **^*|||| |      |  |     ||||  | |   | |      |  |    | |   |          || ||||||||  |||   |   |||| |   |  ||  | |     | | |  |         |  |  |  |  |                |  | |       | ||     |||| |               || ||               |   | ||  | |  || ||||||                        |  |                        |  || 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    ||  |       |  |  |||| |      |  |     ||||  | |   ^**      |  |    | |   |          || ||||||||  |||   |   |||| |   |  ||  | |     | | |  |         |  |  |  |  |                |  | |       ^**|     |||| |               || ||               |   ^**|  | |  || ||||||                        |  |                        |  || 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    ||  |       |  |  |||| |      ^***     ||||  | |            |  |    | |   |          || |^***||^***||   |   |||| |   |  ||  | |     | | ^***         |  |  |  |  |                |  | |       ^***     ||^***               || ||               |   ^***  | |  || ||||||                        |  |                        |  || 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|    ||  |       |  |  |||| |               ||||  | |            |  |    | |   |          || |||| |||   ||   |   |||| |   |  ||  | |     | |              |  |  |  |  |                |  | |         ********^|| |               || ||               |   |     | |  || ||||||                        |  |                        |  || 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****|  |       |  |  |||| |               ||||  | |            |  |    | |   |          || |||| |||   ||   |   |||| |   |  ||  | |     | |              |  |  |  |  |                |  | |                | || |               || ||               |   |     | |  || ||||||                        |  |                        |  || 
search RasMol script viewer Motif-ligand binding stats  PDEASE_I ..      |  |       |  |  |||| |               ||||  | |            |  |    | |   |          || |||| |||   ||   |   |************|  | |     | |              |  |  |  |  |                |  | |                | || |               || ||               |   |     | |  || ||||||                        |  |                        |  || 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      |  |       |  |  |||| |               ||||  | |            |  |    | |   |          || ||*****|   ||   |   | || |   |   |  | |     | |              |  |  |  |  |                |  | |                | || |               || ||               |   |     | |  *********                        |  |                        ***** 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..      |  |       |  |  |||| |               ||||  | |            |  |    | *****          || |||| |||   ||   |   | || |   *****  | |     | |              |  |  |  |  |                |  | |                | || |               || ||               |   |     | |  || |*****                        |  |                        |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..      |  |       |  |  |*** |               ||||  | |            |  |    | |              || |||| |||   ||   |   | || |          | |     | |              |  |  |  |  |                |  ***                ******               || ||               |   |     | |  || |***||                        |  |                        |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |  |       |  |  | |  |               ||||  | |            |  |    | |              |********||   ||   |   | || |          | |     | |              *******  ****                |  |                  |  |                 ****|               |   |     | |  ********|                        ****                        ****  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      |  |       |  |  | |  |               ||||  | |            |  |    ***              |  ||||  ||   ||   |   | || |          | |     | |              |  |     |  |                |  |                  |  |                  |  |               |   |     | |   |  ||  |                                                          
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |       |  |  | |  |               ****  ***            |  |                     |  ****  ||   ||   |   | || |          ***     ***              |  |     |  |                |  |                  |  |                  |  |               |   |     ***   |  ||  |                                                          
search RasMol script viewer Motif-ligand binding stats  niche ..      ****       ******* ****                                    ****                     |    |****|   ||   |   ******                                   ****     ****                ****                  ****                  ****               |   |           ********                                                          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                          ******    |   ||   |                                                                                                                                        |   |                                                                             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                    *****|   |                                                                                                                                        |   |                                                                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                         *****                                                                                                                                        *****                                                                             

   New search    3dyq:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors