triangle PDBeMotif: 3dlx  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.8.3.5
Classification transferase    | release date: Mon, Jun 30, 2008
Title crystal structure of human 3-oxoacid coa transferase 1
Authors A.K.ROOS, A.M.EDWARDS, C.BOUN, C.H.ARROWSMITH, DELFT, E.M.MACLE, J.W.MURRAY, K.L.KAVANAGH, M.WIKSTROM, N.SHAFQAT, S.PICAUD, STRUCTURAL GENOMICS CONSORTIUM (SGC), U.OPPERMANN, W.W.YUE
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Small molecules:    search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
MTKFYTDPVEAVKDIPDGATVLVGGFGLCGIPENLIDALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGE
NAEFERQYLSGELEVELTPQGTLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREVREFNGQHFI
LEEAITGDFALVKAWKADRAGNVIFRKSARNFNLPMCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKR
IERLSIRKEGDGEAKSAKPGDDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHE
ADADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSAKTKVV
VTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQQI
ANAENLYFQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
member of: CATH:search3.40.1080.10GENE3D:searchG3DSA_3.40.1080.10/searchG3DSA_3.40.810.20PANTHER:searchPTHR13707/searchPTHR13707_SF30PFAM:searchPF01144PIRSF:searchPIRSF000858PROSITE PATTERNS:searchPS01273/searchPS01274, SMART:searchSM00882SUPERFAMILY:searchSSF100950TIGRFAMS:searchTIGR02428/searchTIGR02429UniProt:searchP55809
JMol viewer RasMol script viewer  GOL 1A  ..                                                                                                                      ****                                                                                                                             ..GOL ..                                                                                                                                  *   *                             ***                                                        
sec str:  ...eee.hhhhhhh......eeee........hhhhhhhhhhhh...eeee..........hhhhhhh..eeeeee.....hhhhhhhhhh...eeee.hhhhhhhhhhhhhhh..eeee.....hhhhhh..eeee.....eeee.....eeee..eeeeeee...eeeeeee..eee....ee.hhhhh.hhhhhh..eeeeeeee.eee.....hhhhh..hhhhh.eeee.................. ....hhhhhhhhhhhhhhh....eeee..hhhhhhhhhh......eeee...eeee....hhhhh.............eeeeeee.hhhhhhhhhhh....eeee...eee....ee..ee...ee....hhhhhh.....eeeee....hhhhh..ee..............eee...eeeeee...eeeeeee....hhhhhhh......eeeeeeee.....
sequence :  ..TKFYTDPVEAVKDIPDGATVLVGGFGLCGIPENLIDALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENAEFERQYLSGELEVELTPQGTLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREVREFNGQHFILEEAITGDFALVKAWKADRAGNVIFRKSARNFNLPMCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIERLSIRK... ..PGDDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQQIA
seq num:  ..40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280    ... ..297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   | | |  |  ||| |       ||||||  |      | |                   || ||||      ||| | |  |   ||||        |  |   |  | |    ||||| | |      || | ||| ||                                 | |||   | |||      |  |  |  |       | ||| |||||| ||         | |    | | ..PS00001..            || ||| ||   |       || ||| ^*** |  || | ||    || ||| ||   | |    |  |   |  |      ||||          | |||     | |||  ||  || |  | ||        ||| | | |   | |  |||| |    | ||          |  | |  ||  |||  || |  || ||       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | | |  |  ||| |       ||||||  |      | |                   || ||||      ||| | |  |   ||||        |  |   |  | |    ||||| | |      || | ||| ||                                 | |||   | ^**      |  |  |  |       | ||| |||||| ||         | |    ^** ..PS00005..            || ||| ||   |       || ||| ||   |  || | ||    || ||| ||   | |    |  |   |  |      ||||          | |||     | |||  ||  || |  ^**|        ^** | | |   | |  ^**| |    ^**|          |  | |  ||  |||  || |  |^**|       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | | |  |  ||| |       ||||||  |      | |                   || ||||      ||| | |  |   ||||        ^***   |  | |    ||||| | |      || | ||| ||                                 | |||   |  |       |  |  ^***       | ||| |||||| ||         | |        ..PS00006..            || ||| ||   |       || ||| ||   |  || | ||    || ||| ||   | |    |  |   ^***      ||||          | |||     | |||  ||  || |  | ||         |  | | |   | |  || | |    | ||          ^*** |  |^***||  ^***  || ||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | | |  |  ||| |       |||^*****      | |                   || ||||      ||| | |  |   ||||               |  | |    ||||| | |      || | ||| ||                                 | |||   |  |       |  |             | ||| |||||| ||         | |        ..PS00008..            || ||| ^*****       || ||| ||   |  || | ||    || ||| ||   | |    |  |             ||||          | |||     | |||  ^***** |  | ||         |  | | |   | |  || | |    | ||               |  |    ||  |^*****| ||       
search RasMol script viewer Motif-ligand binding stats  COA_TRANSF_1 ..   | | |  |  ||****************         | |                   || ||||      ||| | |  |   ||||               |  | |    ||||| | |      || | ||| ||                                 | |||   |  |       |  |             | ||| |||||| ||         | |        ..PS01273..            || |||  |           || ||| ||   |  || | ||    || ||| ||   | |    |  |             ||||          | |||     | |||   |  |  |  | ||         |  | | |   | |  || | |    | ||               |  |    ||  |      | ||       
search RasMol script viewer Motif-ligand binding stats  COA_TRANSF_2 ..   | | |  |  ||  |       ||| |          | |                   || ||||      ||| | |  |   ||||               |  | |    ||||| | |      || | ||| ||                                 | |||   |  |       |  |             | ||| |||||| ||         | |        ..PS01274..            || |||  |           || ||| ||   ***^*****|    || ||| ||   | |    |  |             ||||          | |||     | |||   |  |  |  | ||         |  | | |   | |  || | |    | ||               |  |    ||  |      | ||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | | |  |  ||  |       ||| |          | |                   || ||||      ||| | |  |   ||||               |  | |    ||||| | |      || | ||| ||                                 | |||   |  |       |  |             | ||| |||||| ||         | |        ..alphabetamotif..            || |||  |           || ||| ||       | |  |    *****| ||   | |    |  |             ||||          | |||     | |||   |  |  |  | ||         |  | | |   | |  || | |    | ||               |  |    ||  |      | ||       
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | ***  |  ||  |       ||| |          | |                   || ||||      ||| ***  |   ||||               |  | |    ||||| | |      || | ||| ||                                 | |||   |  |       |  |             | ||| |||||| ||         | |        ..asxturn..            || |||  |           || ||| ||       | |  |    || ||***|   | |    |  |             ||||          | |||     | |||   |  |  |  | ||         |  | | |   | |  || | |    | ||               |  |    ||  |      | ||       
search RasMol script viewer Motif-ligand binding stats  betabulge ..   | |    |  ||  |       ||| |          | |                   || ||||      ||| |    |   ||||               |  | |    ||||| | |      ** | ||| **                                 | |||   |  |       |  |             | ||| ||**|| ||         | |        ..betabulge..            || |||  |           || ||| ||       | |  |    || |||  |   | |    |  |             ||||          | |||     | |||   |  |  |  | ||         |  | | |   | |  ** | |    | ||               |  |    ||  |      | ||       
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..   | |    |  ||  |       ||| |          | |                   || ||||      ||| |    |   ||||               |  | |    ||||| | |         *****                                    | |||   |  |       |  |             | ||| ||  || ||         | |        ..betabulgeloop..            || |||  |           || ||| ||       | |  |    || |||  |   | |    |  |             ||||          *****     *****   |  |  |  | ||         |  | | |   | |     | |    | ||               |  |    ||  |      | ||       
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |    |  |****       ||| |          | |                   |****||      ||| |    |   ||||               **** |    ||||| | |         ****|                                    ****|   ****       |  |             | |****|  ****|         | |        ..betaturn..            ****|****           *****| ||       | |  |    ****||  |   | |    |  |             ||||          ****|     ****|   ****  |  | ||         **** | |   | |     | |    | ||               ****    ||  |      | ||       
search RasMol script viewer Motif-ligand binding stats  nest ..   | |    |  ||  |       ||| |          ***                   |  ****      ||| |    |   ****                  ***    ||||| | |           ***                                      ***              |  |             *** |  |   |  |         ***        ..nest..             |  ||  |            |  || ||       ***  |     |  ||  |   ***    |  |             ****            ***       ***         |  | ||              | |   | |     ***    | ||               |  |    ||  |      | ||       
search RasMol script viewer Motif-ligand binding stats  niche ..   ***    ********       *****                                |   ***      *****    |   |                            ******* |                                                                     ****                 ****   ****                    ..niche..             ********            ********         ****     ********          ****              ***                                  *******              ***   ***     ***    ****               ****    |****      ****       
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                              ******                |   |                            | |   | |                                                                                                                         ..schellmannloop..                                     | |                                                                                               | |                                    | |                        |   |      | |        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                    *****                            | |   | |                                                                                                                         ..ststaple..                                     | |                                                                                               | |                                    | |                        *****      | |        
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                     ***   ***                                                                                                                         ..stturn..                                     ***                                                                                               ***                                    ***                                   ***        

chain B : SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
member of: CATH:search3.40.1080.10GENE3D:searchG3DSA_3.40.1080.10/searchG3DSA_3.40.810.20PANTHER:searchPTHR13707/searchPTHR13707_SF30PFAM:searchPF01144PIRSF:searchPIRSF000858PROSITE PATTERNS:searchPS01273/searchPS01274, SMART:searchSM00882SUPERFAMILY:searchSSF100950TIGRFAMS:searchTIGR02428/searchTIGR02429UniProt:searchP55809
sec str:  ...ee..hhhhhhh......eeee..........hhhhhhhhhh...eeeee........hhhhhhhh..eeeeee.....hhhhhhhhhh...eeee.hhhhhhhhhhhhhhh..eeee.....hhhhhh..eeee.....eeee.....eeee..eeeeeee...eeeeeee..eee....ee.hhhhh.hhhhhh..eeeeeeee.eee.....hhhhh..hhhhh.eeee................. ..hhhhhhhhhhhhhhh...eeeee..hhhhhhhhhh.....eeeee...eeee....hhhhh.............eeeeeee.hhhhhhhhhhh....eeee...eee....ee..............hhhhhh.....eeeee...eehhhee.ee..............eee...eeeeee...eeeeeee....hhhhhhhh.....eeeeeeee....
sequence :  ..TKFYTDPVEAVKDIPDGATVLVGGFGLCGIPENLIDALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENAEFERQYLSGELEVELTPQGTLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREVREFNGQHFILEEAITGDFALVKAWKADRAGNVIFRKSARNFNLPMCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIERLSIR... ..DDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGK..VKGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQQI
seq num:  ..40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280   ... ..299       309       319       329       339       349       359       369       379       389       399       409       ..420       430       440       450       460       470       480       490       500       510      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     | |  |  ||| |       ||||||  |      | |  |                || ||||      ||| | |      ||||        |  |      | |    ||||| | |           | | ||                                 | | |   | |||    | || |  |  |       | ||| ||  || ||         | |    | |..PS00001..           |  || ||   |     |  |  || ^*** |  || | ||    || ||| ||   | |    |  |   |  |      ||||       ||   | |         ..  |    | |  | ||        | |   | |   | |  |||| |    | |           | ||     |  ||| ||| |  || ||      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     | |  |  ||| |       ||||||  |      | |  |                || ||||      ||| | |      ||||        |  |      | |    ||||| | |           | | ||                                 | | |   | ^**    | || |  |  |       | ||| ||  || ||         | |    ^**..PS00005..           |  || ||   |     |  |  || ||   |  || | ||    || ||| ||   | |    |  |   |  |      ||||       ||   | |         ..  |    | |  ^**|        ^**   | |   | |  ^**| |    ^**           | ||     |  ||| ||| |  |^**|      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     | |  |  ||| |       ||||||  |      | |  |                || ||||      ||| | |      ||||        ^***      | |    ||||| | |           | | ||                                 | | |   |  |     | || |  ^***       | ||| ||  || ||         | |       ..PS00006..           |  || ||   |     |  |  || ||   |  || | ||    || ||| ||   | |    |  |   ^***      ||||       ||   | |         ..  |    | |  | ||              | |   | |  || | |    | |           ^***     ^***|| |^***  || ||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | |  |  ||| |       |||^*****      | |  |                || ||||      ||| | |      ||||                  | |    ||||| | |           | | ||                                 | | |   |  |     | || |             | ||| ||  || ||         | |       ..PS00008..           |  || ^*****     |  |  || ||   |  || | ||    || ||| ||   | |    |  |             ||||       ||   | |         ..  ^***** |  | ||              | |   | |  || | |    | |             ||        ||| ||^*****| ||      
search RasMol script viewer Motif-ligand binding stats  COA_TRANSF_1 ..     | |  |  ||****************         | |  |                || ||||      ||| | |      ||||                  | |    ||||| | |           | | ||                                 | | |   |  |     | || |             | ||| ||  || ||         | |       ..PS01273..           |  ||  |         |  |  || ||   |  || | ||    || ||| ||   | |    |  |             ||||       ||   | |         ..         |  | ||              | |   | |  || | |    | |             ||        ||| ||      | ||      
search RasMol script viewer Motif-ligand binding stats  COA_TRANSF_2 ..     | |  |  ||  |       ||| |          | |  |                || ||||      ||| | |      ||||                  | |    ||||| | |           | | ||                                 | | |   |  |     | || |             | ||| ||  || ||         | |       ..PS01274..           |  ||  |         |  |  || ||   ***^*****|    || ||| ||   | |    |  |             ||||       ||   | |         ..         |  | ||              | |   | |  || | |    | |             ||        ||| ||      | ||      
search RasMol script viewer Motif-ligand binding stats  asxturn ..     ***  |  ||  |       ||| |          | |  |                || ||||      ||| ***      ||||                  | |    ||||| | |           | | ||                                 *** |   |  |     | || |             | ||| ||  || ||         | |       ..asxturn..           |  ||  |         |  |  || ||       | |  |    || ||***|   | |    |  |             ||||       ||   | |         ..         |  | ||              | |   | |  || | |    | |             ||        ||| ||      | ||      
search RasMol script viewer Motif-ligand binding stats  betabulge ..          |  ||  |       ||| |          | |  |                || ||||      ||| |        ||||                  | |    ||||| | |           | | **                                   | |   |  |     | || |             | ||| ||  || ||         | |       ..betabulge..           |  ||  |         |  |  || ||       | |  |    || |||  |   | |    |  |             ||||       **   | |         ..         |  | ||              | |   | |  ** | |    | |             **        ||| ||      | ||      
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |****       ||| |          | |  |                |****||      ||| |        ||||                  | |    ||||| | |           | |                                      | |   ****     **** |             | |****|  *****         | |       ..betaturn..           |  |****         ****  || ||       | |  |    ****||  |   | |    ****             ||||            | |         ..         |  | ||              | |   | |     | |    | |                       ||| ||      | ||      
search RasMol script viewer Motif-ligand binding stats  nest ..          |  ||  |       ||| |          ***  |                |  ****      ||| |        ****                  ***    ||||| | |           ***                                      ***              |  |             *** |  |   |  |         ***       ..nest..           |  ||  |            |  || ||       ***  |     |  ||  |   ***    |  |             ****            ***         ..         |  | ||              | |   | |     ***    | |                       ||| ||      | ||      
search RasMol script viewer Motif-ligand binding stats  niche ..          ********       *****          | ****                |    |       *****                                     ******* |                                                                     ****             *** ****   ****                   ..niche..           ********            ********         ****     ********          ****              ***                        ..         *******              ***   ***     ***    | |                       ||****      ****      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                        | |                   ******                                                 | |   | |                                                                                                                        ..schellmannloop..                                   | |                                                                                  ..            | |                                    | |                       ||  ||      | |       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                        | |                                                                          | |   | |                                                                                                                        ..ststaple..                                   | |                                                                                  ..            | |                                    | |                       ******      | |       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                        ***                                                                          ***   ***                                                                                                                        ..stturn..                                   ***                                                                                  ..            ***                                    ***                                   ***       

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
member of: CATH:search3.40.1080.10GENE3D:searchG3DSA_3.40.1080.10/searchG3DSA_3.40.810.20PANTHER:searchPTHR13707/searchPTHR13707_SF30PFAM:searchPF01144PIRSF:searchPIRSF000858PROSITE PATTERNS:searchPS01273/searchPS01274, SMART:searchSM00882SUPERFAMILY:searchSSF100950TIGRFAMS:searchTIGR02428/searchTIGR02429UniProt:searchP55809
JMol viewer RasMol script viewer  GOL 1C  ..                                                                                                                      ****                                                                                                                            ..GOL ..                                                                                                                                *   *                             ***                                                        
sec str:  ...eee.hhhhhhh......eeee........hhhhhhhhhhhh...eeee..........hhhhhhh..eeeeee.....hhhhhhhhhh...eeee.hhhhhhhhhhhhhh...eeee.....hhhhhh..eeee.....eeee.....eeee..eeeeeee...eeeeeee..eee....ee.hhhhh.hhhhhh..eeeeeeee.eee.....hhhhh..hhhhh.eeee................. ..hhhhhhhhhhhhhhh...eeeee..hhhhhhhhhh.....eeeee...eeee....hhhhh.............eeeeeee.hhhhhhhhhhh....eeee...eee....ee.............hhhhhh.....eeeee....hhhhh..ee..............eee...eeeeee...eeeeeee....hhhhhhh......eeeeeeee.....
sequence :  ..TKFYTDPVEAVKDIPDGATVLVGGFGLCGIPENLIDALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENAEFERQYLSGELEVELTPQGTLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREVREFNGQHFILEEAITGDFALVKAWKADRAGNVIFRKSARNFNLPMCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIERLSIR... ..DDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQQIA
seq num:  ..40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280   ... ..299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          |  ||| |      |||||||  |      | |  |        |  |   |   ||||       |  | |  |   ||||        |  |      | |    ||||| | |      || | |||                                      | |   | |||  |   |  |  |  |     | ||||| ||   |  |         | |    | |..PS00001..| | |     || ||| ||   |        |  || ^*** |  || | ||    || ||| ||   | |    |  |   |  |      ||||          | |||            ||  || |  | ||        ||| | | |   | |  |||| |    | ||    |   | |  | |  ||  ||| ||| |  || ||       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          |  ||| |      |||||||  |      | |  |        |  |   |   ||||       |  | |  |   ||||        |  |      | |    ||||| | |      || | |||                                      | |   | ^**  |   |  |  |  |     | ||||| ||   |  |         | |    ^**..PS00005..| | |     || ||| ||   |        |  || ||   |  || | ||    || ||| ||   | |    |  |   |  |      ||||          | |||            ||  || |  ^**|        ^** | | |   | |  ^**| |    ^**|    |   | |  | |  ||  ||| ||| |  |^**|       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  ||| |      |||||||  |      | |  |        |  |   |   ||||       |  | |  |   ||||        ^***      | |    ||||| | |      || | |||                                      | |   |  ||  |   |  |  ^***     | ||||| ||   |  |         | |       ..PS00006..| | |     || ||| ||   |        |  || ||   |  || | ||    || ||| ||   | |    |  |   ^***      ||||          | |||            ||  || |  | ||         |  | | |   | |  || | |    | ||    |   | ^*** |  |^***|| |^***  || ||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          |  ||| |      ||||^*****      | |  |        |  |   |   ||||       |  | |  |   ||||                  | |    ||||| | |      || | |||                                      | |   |  ||  |   |  |           | ||||| ||   |  |         | |       ..PS00008..| | |     || ||| ^*****        |  || ||   |  || | ||    || ||| ||   | |    |  |             ||||          | |||            ^***** |  | ||         |  | | |   | |  || | |    | ||    |   |      |  |    || ||^*****| ||       
search RasMol script viewer Motif-ligand binding stats  COA_TRANSF_1 ..          |  ||****************         | |  |        |  |   |   ||||       |  | |  |   ||||                  | |    ||||| | |      || | |||                                      | |   |  ||  |   |  |           | ||||| ||   |  |         | |       ..PS01273..| | |     || |||  |            |  || ||   |  || | ||    || ||| ||   | |    |  |             ||||          | |||             |  |  |  | ||         |  | | |   | |  || | |    | ||    |   |      |  |    || ||      | ||       
search RasMol script viewer Motif-ligand binding stats  COA_TRANSF_2 ..          |  ||  |      |||| |          | |  |        |  |   |   ||||       |  | |  |   ||||                  | |    ||||| | |      || | |||                                      | |   |  ||  |   |  |           | ||||| ||   |  |         | |       ..PS01274..| | |     || |||  |            |  || ||   ***^*****|    || ||| ||   | |    |  |             ||||          | |||             |  |  |  | ||         |  | | |   | |  || | |    | ||    |   |      |  |    || ||      | ||       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          |  ||  |      |||| |          | |  |        |  |   |   ||||       |  | |  |   ||||                  | |    ||||| | |      || | |||                                      | |   |  ||  |   |  |           | ||||| ||   |  |         | |       ..asxmotif..*****     || |||  |            |  || ||       | |  |    || ||| ||   | |    |  |             ||||          | |||             |  |  |  | ||         |  | | |   | |  || | |    | ||    *****      |  |    || ||      | ||       
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  ||  |      |||| |          | |  |        |  |   |   ||||       |  ***  |   ||||                  | |    ||||| | |      || | ***                                      | |   |  ||  |   |  |           | ||||| ||   |  |         | |       ..asxturn..***       || |||  |            |  || ||       | |  |    || ||***|   | |    |  |             ||||          | |||             |  |  |  | ||         |  | | |   | |  || | |    | ||               |  |    || ||      | ||       
search RasMol script viewer Motif-ligand binding stats  betabulge ..          |  ||  |      |||| |          | |  |        |  |   |   ||||       |  |    |   ||||                  | |    ||||| | |      ** | |||                                      | |   |  ||  |   |  |           | ||||| ||   |  |         | |       ..betabulge..          || |||  |            |  || ||       | |  |    || |||  |   | |    |  |             ||||          | |||             |  |  |  | ||         |  | | |   | |  ** | |    | ||               |  |    || ||      | ||       
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..          |  ||  |      |||| |          | |  |        |  |   |   ||||       |  |    |   ||||                  | |    ||||| | |         *****                                      | |   |  ||  |   |  |           | ||||| ||   |  |         | |       ..betabulgeloop..          || |||  |            |  || ||       | |  |    || |||  |   | |    |  |             ||||          *****             |  |  |  | ||         |  | | |   | |     | |    | ||               |  |    || ||      | ||       
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  ||  |      **** |          | |  |        |  |   |   ||||       |  |    |   ||||                  | |    ||||| | |         ****|                                      | |   ********   |  |           ****|****|   ****         | |       ..betaturn..          ****||  |            |  || ||       | |  |    ****||  |   | |    ****             ||||          ****|             ****  |  | ||         **** | |   | |     | |    | ||               ****    ****|      | ||       
search RasMol script viewer Motif-ligand binding stats  nest ..          |  ||  |       ||| |          ***  |        |  |   |   ****       |  |    |   ****                  ***    ||||| | |           ***                                      ***              |  |             *** |  |   |  |         ***       ..nest..           |  ||  |            |  || ||       ***  |     |  ||  |   ***    |  |             ****            ***                   |  | ||              | |   | |     ***    | ||               |  |     |  |      | ||       
search RasMol script viewer Motif-ligand binding stats  niche ..          ********       *****            ****        ****   |   |          ****    |   |                            ******* |                                                                     ****             *** ****   ****                   ..niche..           ********            ********         ****     ********          ****              ***                                  *******              ***   ***     ***    ****               ****     ****      ****       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                             *****                  *****                            | |   | |                                                                                                                        ..ststaple..                                   | |                                                                                               | |                                    | |                                   | |        
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                     ***   ***                                                                                                                        ..stturn..                                   ***                                                                                               ***                                    ***                                   ***        

chain D : SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
member of: CATH:search3.40.1080.10GENE3D:searchG3DSA_3.40.1080.10/searchG3DSA_3.40.810.20PANTHER:searchPTHR13707/searchPTHR13707_SF30PFAM:searchPF01144PIRSF:searchPIRSF000858PROSITE PATTERNS:searchPS01273/searchPS01274, SMART:searchSM00882SUPERFAMILY:searchSSF100950TIGRFAMS:searchTIGR02428/searchTIGR02429UniProt:searchP55809
sec str:  ...eee.hhhhhhh......eeee........hhhhhhhhhhhh...eeee..........hhhhhhh..eeeeee.....hhhhhhhhhh...eeee.hhhhhhhhhhhhhhh..eeee.....hhhhhh..eeee......eeee.....eeee..eeeeeee...eeeeeee..eee....ee.hhhhh.hhhhhhhheeeeeeee.eee.....hhhhh..hhhhh.eeee.................. ..hhhhhhhhhhhh....eeee..hhhhhhhhhh......eeee...eeeee....................eeeeeeee.hhhhhhhhhhh....eeee...eee....ee.............hhhhhh.....eeeee....hhhhh..ee..............eee...eeeeee...eeeeeee.... ....hhhhh.................
sequence :  ..TKFYTDPVEAVKDIPDGATVLVGGFGLCGIPENLIDALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENAEFERQYLSGELEVELTPQGTLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNK..GSVAIASKPREVREFNGQHFILEEAITGDFALVKAWKADRAGNVIFRKSARNFNLPMCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIERLSIRK... ..RERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELW... ..DDVQKSTGCDFAVSPKLMPMQQIA
seq num:  ..40        50        60        70        80        90        100       110       120       130       140       150       160       170    ..178       188       198       208       218       228       238       248       258       268       278      ... ..302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482      ... ..496       506       516 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          |  ||| |       ||||||  |      | |  |        |  ||  ||| ||||      ||| |   |||| ||||        |  |      | |    ||| | | |      ||   ..   ||         |  |                    | |||   | |||  |   |  |  |  |       | ||| ||  || ||         | |    | | ..PS00001..      ||||||| ||   |   || |||  || ^*** | ||||| ||    || ||| ||   | |    |  |   |  |    | ||||       || | |||            ||  || |  | ||        | |   | |   | |  |||| |    | |           |  |  ..PS00001.. |||  || |  || |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          |  ||| |       ||||||  |      | |  |        |  ||  ||| ||||      ||| |   |||| ||||        |  |      | |    ||| | | |      ||   ..   ||         |  |                    | |||   | ^**  |   |  |  |  |       | ||| ||  || ||         | |    ^** ..PS00005..      ||||||| ||   |   || |||  || ||   | ||||| ||    || ||| ||   | |    |  |   |  |    | ||||       || | |||            ||  || |  ^**|        ^**   | |   | |  ^**| |    ^**           |  |  ..PS00005.. |||  || |  |^**        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  ||| |       ||||||  |      | |  |        |  ||  ||| ||||      ||| |   |||| ||||        ^***      | |    ||| | | |      ||   ..   ||         |  |                    | |||   |  ||  |   |  |  ^***       | ||| ||  || ||         | |        ..PS00006..      ||||||| ||   |   || |||  || ||   | ||||| ||    || ||| ||   | |    |  |   ^***    | ||||       || | |||            ||  || |  | ||              | |   | |  || | |    | |           ^***  ..PS00006..**||  ^***  |           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          |  ||| |       |||^*****      | |  |        |  ||  ||| ||||      ||| |   |||| ||||                  | |    ||| | | |      ||   ..   ||         |  |                    | |||   |  ||  |   |  |             | ||| ||  || ||         | |        ..PS00008..      ||||||| ^*****   || |||  || ||   | ||||| ||    || ||| ||   | |    |  |           | ||||       || | |||            ^***** |  | ||              | |   | |  || | |    | |                 ..PS00008..  ||  |^*****           
search RasMol script viewer Motif-ligand binding stats  COA_TRANSF_1 ..          |  ||****************         | |  |        |  ||  ||| ||||      ||| |   |||| ||||                  | |    ||| | | |      ||   ..   ||         |  |                    | |||   |  ||  |   |  |             | ||| ||  || ||         | |        ..PS01273..      |||||||  |       || |||  || ||   | ||||| ||    || ||| ||   | |    |  |           | ||||       || | |||             |  |  |  | ||              | |   | |  || | |    | |                 ..PS01273..  ||  |                 
search RasMol script viewer Motif-ligand binding stats  COA_TRANSF_2 ..          |  ||  |       ||| |          | |  |        |  ||  ||| ||||      ||| |   |||| ||||                  | |    ||| | | |      ||   ..   ||         |  |                    | |||   |  ||  |   |  |             | ||| ||  || ||         | |        ..PS01274..      |||||||  |       || |||  || ||   ***^*****|    || ||| ||   | |    |  |           | ||||       || | |||             |  |  |  | ||              | |   | |  || | |    | |                 ..PS01274..  ||  |                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  ||  |       ||| |          | |  |        |  ||  ||| ||||      ||| |   |||| ||||                  | |    ||| | | |      ||   ..   ||         |  |                    | |||   |  ||  |   |  |             | ||| ||  || ||         | |        ..alphabetamotif..      |||||||  |       || |||  || ||     | |||  |    *****| ||   | |    |  |           | ||||       || | |||             |  |  |  | ||              | |   | |  || | |    | |                 ..alphabetamotif..  ||  |                 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          |  ||  |       ||| |          | |  |        |  ||  ||| ||||      ||| *****||| ||||                  | |    ||| | | |      ||   ..   ||         |  |                    *****   |  ||  |   |  |             | ||| ||  || ||         | |        ..asxmotif..      |||||||  |       || |||  || ||     | |||  |    || ||| ||   | |    |  |           | ||||       || | |||             |  |  |  | ||              | |   | |  || | |    | |                 ..asxmotif..  ||  |                 
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  ||  |       ||| |          | |  |        |  ||  ||| ||||      ||| |    ||| ||||                  | |    ||| | | |      ||   ..   ||         |  |                    ***||   |  ||  |   |  |             | ||| ||  || ||         | |        ..asxturn..      |||||||  |       || |||  || ||     | |||  |    || ||***|   | |    |  |           | ||||       || | |||             |  |  |  | ||              | |   | |  || | |    | |                 ..asxturn..  ||  |                 
search RasMol script viewer Motif-ligand binding stats  betabulge ..          |  ||  |       ||| |          | |  |        |  ||  ||| ||||      ||| |    ||| ||||                  | |    ||| | | |      **   ..   **         |  |                    | |||   |  ||  |   |  |             | ||| ||  || ||         | |        ..betabulge..      |||||||  |       || |||  || ||     | |||  |    || |||  |   | |    |  |           | ||||       ** | |||             |  |  |  | ||              | |   | |  ** | |    | |                 ..betabulge..  ||  |                 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..          |  ||  |       ||| |          | |  |        |  ||  ||| ||||      ||| |    ||| ||||                  | |    ||| | | |           ..              |  |                    *****   |  ||  |   |  |             | ||| ||  || ||         | |        ..betabulgeloop..      |||||||  |       || |||  || ||     *****  |    || |||  |   | |    |  |           | ||||          *****             |  |  |  | ||              | |   | |     | |    | |                 ..betabulgeloop..  ||  |                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |****       ||| |          | |  |        |  |****|****||      ||| |    ||****||                  | |    ||| | | |           ..              ****                    ****|   ********   |  |             | |****|  ****|         | |        ..betaturn..      *****||  |       *********| ||     ****|  |    ****||  |   | |    ****           ****||          ****|             ****  |  | ||              | |   | |     | |    | |                 ..betaturn..  ||  |                 
search RasMol script viewer Motif-ligand binding stats  nest ..          |  ||  |       ||| |          ***  |        |  |   ||  ****      ||| |    ||  ****                  ***    ||| | | |           ..                                        ***              |  |             *** |  |   |  |         ***        ..nest..        |  ||  |            |  || ||       ***  |     |  ||  |   ***    |  |             ****            ***                   |  | ||              | |   | |     ***    | |                 ..nest..  ||  |                 
search RasMol script viewer Motif-ligand binding stats  niche ..          ********       *****          | ****        ****   ||  |***      *****    ||  | |                          ***** | |           ..                                                         ****             *** ****   ****                    ..niche..        ********            ********         ****     ********          ****              ***                                  *******              ***   ***            | |                 ..niche..  |****                 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                        | |                  |******                |******                          | |   | |           ..                                                                                                             ..schellmannloop..                                | |                                                                                               | |                                    | |                 ..schellmannloop..  |   |                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                        | |                  *****                  *****                            | |   | |           ..                                                                                                             ..ststaple..                                | |                                                                                               | |                                    | |                 ..ststaple..  *****                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                        ***                                                                          ***   ***           ..                                                                                                             ..stturn..                                ***                                                                                               ***                                    ***                 ..stturn..                        

   New search    3dlx:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors