triangle PDBeMotif: 3dju  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transcription    | release date: Tue, Jun 24, 2008
Title crystal structure of human btg2
Authors H.WANG, M.BARTLAM, M.MORITA, T.SUZUKI, T.YAMAMOTO, X.YANG
Method X-RAY DIFFRACTION (resolution: 2.26Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain B sequence:
TDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIG
LSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : PROTEIN BTG2
member of: PANTHER:searchPTHR22978/searchPTHR22978_SF25PFAM:searchPF07742PRINTS:searchANTIPRLFBTG1PROSITE PATTERNS:searchPS00960/searchPS01203, SMART:searchSM00099SUPERFAMILY:searchSSF160696UniProt:searchP78543
sec str:  ....hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..........hhhhhheee....hhhhhhhhhh...hhhhhhhhh...eeeeee..eeeeee.....eeeeee...
sequence :  ..TDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAP
seq num:  ..7         17        27        37        47        57        67        77        87        97        107       117        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          |   |         |   |              |  |    |  || |  |  || | |   |  || |||     |  |        |  | ^** || |    ||    
search RasMol script viewer Motif-ligand binding stats  BTG_1 ..          |   |         |   |              *********************| | |   |  || |||     |  |        |  |     || |    ||    
search RasMol script viewer Motif-ligand binding stats  BTG_2 ..          |   |         |   |              |  |    |  || |  |   | | |   |  || |||     |  ******************** |    ||    
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          |   |         |   |              |  |    |  || |  |   | | *****  || |||     |  |        |  |     |  |    ||    
search RasMol script viewer Motif-ligand binding stats  betabulge ..          |   |         |   |              |  |    |  || |  |   | |        || |||     |  |        |  |     |  |    **    
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |   |         |   |              ****    |  || |  |   | |        *****|     |  |        |  |     |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..          |   |         |   |                      |  |***  |   | |           ***     |  |        |  |     |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..          |   |         |   |                      ****  ****   ***                   ****        ****     ****          
search RasMol script viewer Motif-ligand binding stats  stmotif ..          |   |         *****                                                                                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..          *****                                                                                                          

   New search    3dju:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors