triangle PDBeMotif: 3dc6  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.15.1.1
Classification oxidoreductase    | release date: Tue, Jun 3, 2008
Title crystal structure of a manganese superoxide dismutases from caenorhabditis elegans
Authors C.H.TRINH, E.E.STEWART, G.J.HUNTER, S.E.V.PHILLIPS, T.HUNTER
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Small molecules:    search MN MN binding statistics MN   search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,C sequence:
MKHSLPDLPYDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNVKEAIALQPALKFNGGGHINHSIFWT
NLAKDGGEPSAELLTAIKSDFGSLDNLQKQLSASTVAVQGSGWGWLGYCPKGKILKVATCANQDPLEATTGLVPLFGIDV
WEHAYYLQYKNVRPDYVNAIWKIANWKNVSERFAKAQQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SUPEROXIDE DISMUTASE [MN] 1
member of: CATH:search1.10.287.990GENE3D:searchG3DSA_1.10.287.990PANTHER:searchPTHR11404/searchPTHR11404_SF6PFAM:searchPF00081/searchPF02777PIRSF:searchPIRSF000349PRINTS:searchMNSODISMTASEPROSITE PATTERNS:searchPS00088, SUPERFAMILY:searchSSF46609/searchSSF54719UniProt:searchP31161
JMol viewer RasMol script viewer  SO4 200A  .. **                                                                   *                                                                                                                              
JMol viewer RasMol script viewer  SO4 199A  .. ||       *            *   *                                          |                                                                                                                              
JMol viewer RasMol script viewer  MN 198A  .. ||       |            | * |                                          |  *                                                                                   *   *                                   
sec str:  ....................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee....eeeeeeee...hhhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..KHSLPDLPYDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNVKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSAELLTAIKSDFGSLDNLQKQLSASTVAVQGSGWGWLGYCPKGKILKVATCANQDPLEATTGLVPLFGIDVWEHAYYLQYKNVRPDYVNAIWKIANWKNVSERFAKAQQ
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  |     |  |  ||   |     |   |              || |||    |  |       |   ^*** |  |   |   ||  |       ||   |       |  | |    |      | |      || |||  || |  ||  | | || |             || ||   ^***|      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  |     |  |  ||   |     |   |              || |||    |  |       |    |   |  |   |   ||  |       ||   |       |  | |    |      | |      || |||  || |  ||  | | || |             || ||     ^**      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ^***     |  |  ||   |     |   |              || |||    |  |       |    |   |  |   |   ||  |       ||   |       |  | |    |      | |      || |||  || |  ||  | | || |             || ||              
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |  |  ||   |     |   |              || |||    |  |       ^*****   |  |   ^*****  |       ^*****       |  | ^*****      | |      || |||  || |  ||  | | || |             || ||              
search RasMol script viewer Motif-ligand binding stats  SOD_MN ..           |  |  ||   |     |   |              || |||    |  |                |  |       |   |        |   |       |  |             | |      || |||  || |  ||  ^***^***             || ||              
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |  |  ||   |     |   |              || |||    |  |                |  |       |   |        |   |       |  |             | |      || |||  || |  ||  | |  |               *****              
search RasMol script viewer Motif-ligand binding stats  asxturn ..           |  |  ||   |     |   |              || |||    |  |                |  |       |   |        |   |       |  |             | |      || |||  || |  ||  ***  |               || ||              
search RasMol script viewer Motif-ligand binding stats  betabulge ..           |  |  ||   |     |   |              || |||    |  |                |  |       |   |        |   |       |  |             | |      || |||  || |  **  | |  |               || ||              
search RasMol script viewer Motif-ligand binding stats  betaturn ..           |  |  ||   |     |   |              |****|    ****                |  |       |   |        |   |       |  |             | |      ****||  || |      | ****               ****|              
search RasMol script viewer Motif-ligand binding stats  nest ..           |  |  ||   |     |   |              |  ***                        |  |       |   |        |   |       |  |             ***       | |||  |***      | |                   |  |              
search RasMol script viewer Motif-ligand binding stats  niche ..           *******|   |     |   |              |    |                        ****       |   |        |   |       ****                       ***||  || |      ***                   ****              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                  |   |     |   |              ******                                   |   |        |   |                                     ||  || |                                              
search RasMol script viewer Motif-ligand binding stats  stmotif ..                  *****     |   |                                                       *****        *****                                     ||  || |                                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                            *****                                                                                                              ****** |                                              
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                    ***                                              

chain C : SUPEROXIDE DISMUTASE [MN] 1
member of: CATH:search1.10.287.990GENE3D:searchG3DSA_1.10.287.990PANTHER:searchPTHR11404/searchPTHR11404_SF6PFAM:searchPF00081/searchPF02777PIRSF:searchPIRSF000349PRINTS:searchMNSODISMTASEPROSITE PATTERNS:searchPS00088, SUPERFAMILY:searchSSF46609/searchSSF54719UniProt:searchP31161
JMol viewer RasMol script viewer  SO4 199C  ..  **                                                                   *                                                                                                                              
JMol viewer RasMol script viewer  MN 198C  ..  ||                      *                                            |  *                                                                                   *   *                                   
sec str:  .....................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee....eeeeeeee...hhhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..MKHSLPDLPYDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNVKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSAELLTAIKSDFGSLDNLQKQLSASTVAVQGSGWGWLGYCPKGKILKVATCANQDPLEATTGLVPLFGIDVWEHAYYLQYKNVRPDYVNAIWKIANWKNVSERFAKAQQ
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  |     | ||  |          |   |              || |||               |   ^*** |  |   |    |   |     |||   |  |   ||  | |    |      | |      || | |   | |  ||  | | || |              |  |   ^***|      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  |     | ||  |          |   |              || |||               |    |   |  |   |    |   |     |||   |  |   ||  | |    |      | |      || | |   | |  ||  | | || |              |  |     ^**      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ^***     | ||  |          |   |              || |||               |    |   |  |   |    |   |     |||   |  |   ||  | |    |      | |      || | |   | |  ||  | | || |              |  |              
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            | ||  |          |   |              || |||               ^*****   |  |   ^*****   |     |^*****  |   ||  | ^*****      | |      || | |   | |  ||  | | || |              |  |              
search RasMol script viewer Motif-ligand binding stats  SOD_MN ..            | ||  |          |   |              || |||                        |  |        |   |     | |      |   ||  |             | |      || | |   | |  ||  ^***^***              |  |              
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | *****          |   |              || |||                        |  |        |   |     | |      |   ||  |             | |      || | |   | |  ||  | |  |                |  |              
search RasMol script viewer Motif-ligand binding stats  asxturn ..            |  |  |          |   |              || |||                        |  |        |   |     | |      |   ||  |             | |      || | |   | |  ||  ***  |                |  |              
search RasMol script viewer Motif-ligand binding stats  betabulge ..            |  |  |          |   |              || |||                        |  |        |   |     | |      |   ||  |             | |      || | |   | |  **  | |  |                |  |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |  |  |          |   |              |****|                        |  |        |   |     | |      |   ||  |             | |      **** |   | |      | ****                |  |              
search RasMol script viewer Motif-ligand binding stats  nest ..            |  |  |          |   |              |  ***                        |  |        |   |     ***      |   ||  |             ***       | | |   ***      | |                   |  |              
search RasMol script viewer Motif-ligand binding stats  niche ..            *******          |   |              |    |                        ****        |   |              |   |****                       *** |   | |      ***                   ****              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                             |   |              ******                                    |   |              |   |                               |   | |                                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                             *****                                                        *****              *****                               ***** |                                              
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                     ***                                              

   New search    3dc6:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors