triangle PDBeMotif: 3dc5  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.15.1.1
Classification oxidoreductase    | release date: Tue, Jun 3, 2008
Title crystal structure of a manganese superoxide dismutases from caenorhabditis elegans
Authors C.H.TRINH, E.E.STEWART, G.J.HUNTER, S.E.V.PHILLIPS, T.HUNTER
Method X-RAY DIFFRACTION (resolution: 1.70Å)
PDBe Citation   
Small molecules:    search MLI MLI binding statistics MLI   search MN MN binding statistics MN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,C sequence:
MKHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNLKEAIALQPALKFNGGGHINHSIFWT
NLAKDGGEPSKELMDTIKRDFGSLDNLQKRLSDITIAVQGSGWGWLGYCKKDKILKIATCANQDPLEGMVPLFGIDVWEH
AYYLQYKNVRPDYVHAIWKIANWKNISERFANARQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SUPEROXIDE DISMUTASE [MN] 2
member of: CATH:search1.10.287.990GENE3D:searchG3DSA_1.10.287.990PANTHER:searchPTHR11404/searchPTHR11404_SF6PFAM:searchPF00081/searchPF02777PIRSF:searchPIRSF000349PRINTS:searchMNSODISMTASEPROSITE PATTERNS:searchPS00088, SUPERFAMILY:searchSSF46609/searchSSF54719UniProt:searchP41977
JMol viewer RasMol script viewer  MN 195A  ..                         *                                               *                                                                                *   *                                   
JMol viewer RasMol script viewer  MLI 196A  ..                         |                                               |                                                                                |   |       ** *                        
sec str:  ....................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee....eeeeeeee........eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..KHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNLKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSKELMDTIKRDFGSLDNLQKRLSDITIAVQGSGWGWLGYCKKDKILKIATCANQDPLEGMVPLFGIDVWEHAYYLQYKNVRPDYVHAIWKIANWKNISERFANARQ
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  |     |  |  ||   |                           | |   |           |   ^***|| ||   |    ||   | |   ||   | | ||  |  | |    |      | |      || | |  |  ||  | | || |             || || | ^***|      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  |  |     |  |  ||   |                           | |   |           |    |  || ||   |    ||   | |   ||   | **^*  |  | |    |      | |      || | |  |  ||  | | || |             || || |   | |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  |     |  |  ||   |                           | |   |           |    |  || ||   |    ||   ^**   ||   |   |   |  | |    |      | |      || | |  |  ||  | | || |             || || |   ^**      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ^***     |  |  ||   |                           | |   |           |    |  || ||   |    ||   |     ||   |   |   |  | |    |      | |      || | |  |  ||  | | || |             || || |   |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |  |  ||   |                           | |   |           ^*****  || ||   ^*****|   |     ^*****   |   |  | ^*****      | |      || | |  |  ||  | | || |             || || |   |        
search RasMol script viewer Motif-ligand binding stats  SOD_MN ..           |  |  ||   |                           | |   |                   || ||         |   |      |   |   |   |  |             | |      || | |  |  ||  ^***^***             || || |   |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |  |  ||   |                           | |   |                   || ||         |   |      |   |   |   |  |             | |      || | |  |  ||  | |  |               ***** |   |        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           |  |  ||   |                           | *****                   || ||         |   |      |   |   |   |  |             | |      || | |  |  ||  | |  |               || || |   |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..           |  |  ||   |                           | |                       || ||         |   |      |   |   |   |  |             | |      || | |  |  ||  ***  |               || || |   |        
search RasMol script viewer Motif-ligand binding stats  betabulge ..           |  |  ||   |                           | |                       || ||         |   |      |   |   |   |  |             | |      || | |  |  **  | |  |               || || |   |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..           |  |  ||   |                           | |                       ****|         |   |      |   |   |   |  |             | |      **** |  |      | ****               ****| |   |        
search RasMol script viewer Motif-ligand binding stats  nest ..           |  |  ||   |                           ***                        |  |         |   |      |   |   |   |  |             ***       | | |  |      | |                   |  | |   |        
search RasMol script viewer Motif-ligand binding stats  niche ..           *******|   |                                                      ****         |   |      |   |   |   ****                       *** ****      ***                   **** |   |        
search RasMol script viewer Motif-ligand binding stats  stmotif ..                  *****                                                                   |   |      *****   |   |                                                                   |   |        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                          *****              *****                                                                   *****        

chain C : SUPEROXIDE DISMUTASE [MN] 2
member of: CATH:search1.10.287.990GENE3D:searchG3DSA_1.10.287.990PANTHER:searchPTHR11404/searchPTHR11404_SF6PFAM:searchPF00081/searchPF02777PIRSF:searchPIRSF000349PRINTS:searchMNSODISMTASEPROSITE PATTERNS:searchPS00088, SUPERFAMILY:searchSSF46609/searchSSF54719UniProt:searchP41977
JMol viewer RasMol script viewer  MN 195C  ..                          *                                               *                                                                                *   *                                   
sec str:  .....................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee....eeeeeeee........eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..MKHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNLKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSKELMDTIKRDFGSLDNLQKRLSDITIAVQGSGWGWLGYCKKDKILKIATCANQDPLEGMVPLFGIDVWEHAYYLQYKNVRPDYVHAIWKIANWKNISERFANARQ
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  |   | || |  ||   |     |   |                 | |               |   ^*** |  |   |   ||  | | |   |    | | ||  |  | |    |      | |      || | |  |  ||  | | || |             || || | ^***|      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   |  |   | || |  ||   |     |   |                 | |               |    |   |  |   |   ||  | | |   |    | **^*  |  | |    |      | |      || | |  |  ||  | | || |             || || |   | |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  |   | || |  ||   |     |   |                 | |               |    |   |  |   |   ||  | ^**   |    |   |   |  | |    |      | |      || | |  |  ||  | | || |             || || |   ^**      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ^***   | || |  ||   |     |   |                 | |               |    |   |  |   |   ||  |       |    |   |   |  | |    |      | |      || | |  |  ||  | | || |             || || |   |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | || |  ||   |     |   |                 | |               ^*****   |  |   ^*****  |       ^*****   |   |  | ^*****      | |      || | |  |  ||  | | || |             || || |   |        
search RasMol script viewer Motif-ligand binding stats  SOD_MN ..          | || |  ||   |     |   |                 | |                        |  |       |   |                |   |  |             | |      || | |  |  ||  ^***^***             || || |   |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | || |  ||   |     |   |                 | |                        |  |       |   |                |   |  |             | |      || | |  |  ||  | |  |               ***** |   |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..          | || |  ||   |     |   |                 | |                        |  |       |   |                |   |  |             | |      || | |  |  ||  ***  |               || || |   |        
search RasMol script viewer Motif-ligand binding stats  betabulge ..          | || |  ||   |     |   |                 | |                        |  |       |   |                |   |  |             | |      || | |  |  **  | |  |               || || |   |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..          **** |  ||   |     |   |                 | |                        |  |       |   |                |   |  |             | |      **** |  |      | ****               ****| |   |        
search RasMol script viewer Motif-ligand binding stats  nest ..            |  |  ||   |     |   |                 ***                        |  |       |   |                |   |  |             ***       | | |  |      | |                   |  | |   |        
search RasMol script viewer Motif-ligand binding stats  niche ..            *******|   |     |   |                                            ****       |   |                |   ****                       *** ****      ***                   **** |   |        
search RasMol script viewer Motif-ligand binding stats  stmotif ..                   *****     |   |                                                       *****                |   |                                                                   |   |        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                             *****                                                                            *****                                                                   *****        

   New search    3dc5:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors