triangle PDBeMotif: 3d77  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification pheromone binding protein    | release date: Tue, May 20, 2008
Title crystal structure of a pheromone binding protein mutant d35n, from apis mellifera, soaked at ph 4.0
Authors C.CAMBILLAU, J.C.PERNOLLET, L.BRIAND, M.E.PESENTI, M.TEGONI, S.SPINELLI, V.BEZIRARD
Method X-RAY DIFFRACTION (resolution: 1.70Å)
PDBe Citation   
Small molecules:    search NBB NBB binding statistics NBB   search NA NA binding statistics NA   search EDO EDO binding statistics EDO
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
APDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVNKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQE
RAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PHEROMONE-BINDING PROTEIN ASP1
member of: CATH:search1.10.238.20GENE3D:searchG3DSA_1.10.238.20PANTHER:searchPTHR11857PFAM:searchPF01395SMART:searchSM00708SUPERFAMILY:searchSSF47565UniProt:searchQ9U9J6
JMol viewer RasMol script viewer  EDO 127A  ..*                                                                                                                *  
JMol viewer RasMol script viewer  EDO 126A  ..|         *  *                                                                                                   |  
JMol viewer RasMol script viewer  EDO 125A  ..|         |* |**                                                                                                 |  
JMol viewer RasMol script viewer  EDO 124A  ..|         || |||                     * *                                                                         |  
JMol viewer RasMol script viewer  EDO 123A  ..|         || |||                     | *                                                                         |  
JMol viewer RasMol script viewer  EDO 122A  ..|         || |||                     | *                                                    *                    |  
JMol viewer RasMol script viewer  NBB 121A  ..*         || |||                     | |        **  * *                                     |                   ** *
JMol viewer RasMol script viewer  NA 120A  ..|         || |||                     | *        ||  | |                                     |                   || |
sec str:  ....hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh.....hhhhhhhhhhhhhhh.........hhhhhhh.....hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh.......
sequence :  ..WVPPEVFDLVAEDKARCMSEHGTTQAQIDDVNKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                    ||||  || || |||   |   |       | |^*** | |      |  ||  ||       |  |  ^*** ||         | ^***|||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                    |^*****| || |^*****   |       | ||||  | |      |  ||  ||       |  |   ^*****         |  || |||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                    | ||   | || |||   |   |       | ||||  | |      |  |*****       |  |     | |          |  || |||  
search RasMol script viewer Motif-ligand binding stats  asxturn ..                    | ||   | || |||   |   |       | ||||  | |      |  ||  |        |  |     ***          |  || |||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                    | ||   | |****|   |   |       ****||  | |      |  |****        |  |                  |  || |||  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                    | ||   | |  | |   |   |         ||||  | |      |  |            |  |                  |  || ***  
search RasMol script viewer Motif-ligand binding stats  nest ..                    ***|   | |  ***   |   |         ****  ***      |  |            |  |                  |  ||  |   
search RasMol script viewer Motif-ligand binding stats  niche ..                       |   | |    |   |   |                        ****            ****                  ********   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                       |   | ******   |   |                                                                         
search RasMol script viewer Motif-ligand binding stats  stmotif ..                       *****          |   |                                                                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                      *****                                                                         

   New search    3d77:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors