triangle PDBeMotif: 3cog  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   4.4.1.1
Classification lyase    | release date: Fri, Mar 28, 2008
Title crystal structure of human cystathionase (cystathionine gamm in complex with dl-propargylglycine
Authors A.FLORES, A.G.THORSELL, A.KALLAS, A.M.EDWARDS, C.H.ARROWSMITH, C.PERSSON, H.BERGLUND, H.SCHULER, I.JO, J.SAGERMARK, J.WEIGELT, K.OLESEN, L.G., L.LEHTIO, L.SVENSSON, L.TRES, M.E.NILSSON, M.HAMMARSTROM, M.MOCHE, M.WELIN, M.WI, P.NORDLUND, R.COLLINS, R.D.BUSAM, S.FLODIN, S.GRASLUND, S.VAN DEN BERG, STRUCTURAL GENOMICS CONSORTIUM (SGC), T.KARLBERG, T.KOTENYOVA, T.NYMAN
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search PLP PLP binding statistics PLP   search NO3 NO3 binding statistics NO3   search PEG PEG binding statistics PEG   search GOL GOL binding statistics GOL   search 2AG 2AG binding statistics 2AG
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
SMQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALD
GAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETP
TNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFL
QNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIK
GTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHP
PSG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYSTATHIONINE GAMMA-LYASE
member of: CATH:search3.40.640.10/search3.90.1150.10GENE3D:searchG3DSA_3.40.640.10/searchG3DSA_3.90.1150.10PANTHER:searchPTHR11808/searchPTHR11808_SF15PFAM:searchPF01053PIRSF:searchPIRSF001434PROSITE PATTERNS:searchPS00868, SUPERFAMILY:searchSSF53383UniProt:searchP32929
JMol viewer RasMol script viewer  PEG 609A  ..                                        ..                                                                                                                                                                                                                                       * ******  *                                                                                              
JMol viewer RasMol script viewer  NO3 608A  ..                                        ..                                                  *                                              *                                                  *                                                                                  | ||||||  |                                  **             *                   *                        
JMol viewer RasMol script viewer  GOL 603A  ..                                        ..                                   ***            |                                              |                                                  |                                                                                  | ||||||  |                                  ||             |                   |                        
JMol viewer RasMol script viewer  2AG 501A  ..                                        ..                                   |||            *    *                                         |                                                  |                                                                                  | ||||||  |                                 *||             |                   |                        
JMol viewer RasMol script viewer  PLP 500A  ..                                        ..                         ***       |||            *    |                                         *                         * *                   * **                                                                                  | ||||||  |                                 |||             |                   |                        
sec str:  .........hhhhhhhhh..hhhhh....................hhhhhhhhhhhhhhhh..eeeee.hhhhhhhhhhh......eeeee...hhhhhhhhhhhhhhhh.eeeee...hhhhhhhhh...eeeeeee..........hhhhhhhhhh.....eeeee.................eeeee.............eeeee.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeee........hhhhhhhhh.....eeeeee..hhhhhhhhhhhh...ee.........eee..........hhhhhhhhh....eeeee....hhhhhhhhhhhhhhhhh.
sequence :  ..GFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQ..GNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHP
seq num:  ..10        20        30        40        ..64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |  | ||||||  |^**|     | | ^** ..             | |||   |   ||  |||  |   |  |    | | |  ^**  | | || |   || | ||    |  ||  |           ^**  |   |   |  |       | |  ||| |    ||||  |   ||  |||||       | |             | |  |  |       |  |          |    | |  | ||    |  |  |      |  |   | |               |  |   |  |  || ||| |      |  |       |||| ||     | |            |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |  | ||||||  | |||     | |     ..             | |||   |   ||  |||  |   |  |    | | |       | | || |   ^*** ||    |  ||  |           | |  |   |   |  |       | |  ||| |    ||||  |   ||  |||||       | |             | |  ^***       |  |          |    | |  | ||    |  |  |      |  |   | |               |  |   ^***  || |^***      |  |       |||| ||     | |            |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |  | ||||||  | |||     | |     ..             | |^*****   |^*****  |   |  |    | | |       | | || ^***** | ||    |  ||  |           | |  |   |   |  |       | |  ||| |    |^*****   ||  |||||       | |             | |             |  |          ^***** |  | ||    |  |  |      |  |   | |               |  |         ^*****        |  |       |^*****     | |            |     
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..       | |  | ||||||  | |||     | |     ..             | |||       |   ||   |   |  |    | | |       | | ||        | ||    |  ||  |           | |  |   |   |  |       | |  ||| |    | ||      ||  |||||       | |             | |             |  |                 |  | ||    |  |  |      |  |   | |               |  |          | |          |  |       | || |**********************     
search RasMol script viewer Motif-ligand binding stats  CYS_MET_METAB_PP ..       | |  | ||||||  | |||     | |     ..             | |||       |   ||   |   |  |    | | |       | | ||        | ||    |  ||  |           | |  |   |   |  |       | |  ||| |    | |*******^*******|       | |             | |             |  |                 |  | ||    |  |  |      |  |   | |               |  |          | |          |  |       | || ||     | |                  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       | |  | ||||||  | |||     | |     ..             | |||       |   ||   |   |  |    | | |       | | ||        | ||    |  ||  |           | |  *****   |  |       | |  ||| |    | |        |  |||||       | |             | |             |  |                 |  | ||    |  |  |      |  |   | |               |  |          | |          |  |       | || ||     | |                  
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |  | ||||||  | |||     | |     ..             | |||       |   ||   |   |  |    | | |       | | ||        ***|    |  ||  |           | |          |  |       ***  ||| |    | |        |  |||||       | |             | |             |  |                 |  ***|    |  |  |      |  |   | |               |  |          | |          |  |       | || ||     | |                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |  | ****||  ****|     | |     ..             ****|       |   ||   |   ****    | | |       | ****        |  |    |  ||  |           | |          |  |       |    ||| |    | |        |  |||||       | |             | |             ****                 ****  |    |  ****      |  |   | |               |  |          | |          ****       | || ||     | |                  
search RasMol script viewer Motif-ligand binding stats  nest ..       ***  |  |***|  | ***     | |     ..               ***       |   ||   |   |  |    | | |       |   |         |  |    |  ||  |           ***          |  |       |    ||| |    ***        |  *****       | |             ***                                  |  |  |    |  |  |      |  |   | |               |  |          | |          |  |       ***| ||     | |                  
search RasMol script viewer Motif-ligand binding stats  niche ..            *********** | |     ***     ..                         |   ||   |   ****    *** |       |   |         ****    ********                        ****       |    |****               |              ***                                                  *******    *******      ****   ***               ****          ***          ****          ****     ***                  
search RasMol script viewer Motif-ligand binding stats  stmotif ..                        | |             ..                         *****|   |               |       |   |                                                            |    | |                 |                                                                                                                                                             | |                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                        | |             ..                              *****               |       *****                                                            |    | |                 |                                                                                                                                                             | |                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                        ***             ..                                                  |                                                                        |    ***                 |                                                                                                                                                             ***                           
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                        ..                                                  *                                                                        *                        *                                                                                                                                                                                           

chain B : CYSTATHIONINE GAMMA-LYASE
member of: CATH:search3.40.640.10/search3.90.1150.10GENE3D:searchG3DSA_3.40.640.10/searchG3DSA_3.90.1150.10PANTHER:searchPTHR11808/searchPTHR11808_SF15PFAM:searchPF01053PIRSF:searchPIRSF001434PROSITE PATTERNS:searchPS00868, SUPERFAMILY:searchSSF53383UniProt:searchP32929
JMol viewer RasMol script viewer  GOL 604D  ..                      ***                                                                                                                                                                                                                                                                                                                             ..GOL ..                               
JMol viewer RasMol script viewer  NO3 608A  ..                      |||                                                                                                                                                                                                                                                                                                                             ..NO3 ..                               
JMol viewer RasMol script viewer  GOL 603A  ..                      |||                                                                                            *                                                                                                                                                                                                                                ..GOL ..                               
JMol viewer RasMol script viewer  2AG 501A  ..                      |||                         * *                                                                |                                                                                                                                                                                                                                ..2AG ..                               
JMol viewer RasMol script viewer  PLP 500A  ..                      |||                         * *                                                                |                                                                                                                                                                                                                                ..PLP ..                               
sec str:  .........hhhhhhhhh..hhhhh................................hhhhhhhhhhhhhhhh..eeeee.hhhhhhhhhhh......eeeee...hhhhhhhhhhhhhhhh.eeeee...hhhhhhhhh...eeeeeee..........hhhhhhhhhhhh...eeeee.................eeeee.............eeeee.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeee........hhhhhhhhh.....eeeeee..hhhhhhhhhhhh...ee.........eee..... .....eeeee....hhhhhhhhhhhhhhhhh..
sequence :  ..GFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELP... ..SDTLIRLSVGLEDEEDLLEDLDQALKAAHPP
seq num:  ..10        20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340         ... ..370       380       390        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |  |  || ||| |^**|     | | ^**  | || | ||  |              | |||   |   ||  | | |  | |  |        |  ^**  | | |||||  || |  |    |  ||  |           ^**  |   |       | |    | |  ||| |    ||||  |   ||  ||||||      | |             | |  |  |       |  |          |    | |  | ||||  |  |  |      |  |   | |       | |     |  |   |  |  || ||| |  ..PS00005..| ||     | |            |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |  |  || ||| | |||     | |      | || ^***  |              | |||   |   ||  | | |  | |  |        |       | | |||||  ^***  |    |  ||  |           | |  |   |       | |    | |  ||| |    ||||  |   ||  ||||||      | |             | |  ^***       |  |          |    | |  | ||||  |  |  |      |  |   | |       | |     |  |   ^***  || |^***  ..PS00006..| ||     | |            |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |  |  || ||| | |||     | |      | ^*****   |              | |^*****   |^***** |  | |  |        |       | | |||^***** |  |    |  ||  |           | |  |   |       | |    | |  ||| |    |^*****   ||  ||||||      | |             | |             |  |          ^***** |  | ||||  |  |  |      |  |   | |       | |     |  |         ^*****    ..PS00008..****     | |            |      
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..       | |  |  || ||| | |||     | |      |  |       |              | |||       |   |   |  | |  |        |       | | ||| |     |  |    |  ||  |           | |  |   |       | |    | |  ||| |    | ||      ||  ||||||      | |             | |             |  |                 |  | ||||  |  |  |      |  |   | |       | |     |  |          | |      ..PS00029..| |**********************      
search RasMol script viewer Motif-ligand binding stats  CYS_MET_METAB_PP ..       | |  |  || ||| | |||     | |      |  |       |              | |||       |   |   |  | |  |        |       | | ||| |     |  |    |  ||  |           | |  |   |       | |    | |  ||| |    | |*******^*******||      | |             | |             |  |                 |  | ||||  |  |  |      |  |   | |       | |     |  |          | |      ..PS00868..| ||     | |                   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       | |  |  || ||| | |||     | |      |  |       |              | |||       |   |   |  | |  |        |       | | ||| |     |  |    |  ||  |           | |  *****       | |    | |  ||| |    | |        |  ||||||      | |             | |             |  |                 |  | ||||  |  |  |      |  |   | |       | |     |  |          | |      ..asxmotif..| ||     | |                   
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |  |  || *** | |||     | |      |  |       |              | |||       |   |   |  | |  |        |       | | ||| |     |  |    |  ||  |           | |              | |    ***  ||| |    | |        |  ||||||      | |             | |             |  |                 |  ***|||  |  |  |      |  |   | |       | |     |  |          | |      ..asxturn..| ||     | |                   
search RasMol script viewer Motif-ligand binding stats  betabulge ..       | |  |  || ||  | |||     | |      |  |       |              | |||       |   |   |  | |  |        |       | | ||| |     |  |    |  ||  |           | |              | |    |    ||| |    | |        |  ||||||      | |             | |             |  |                 |  |  |**  |  |  |      |  |   | |       | |     |  |          | |      ..betabulge..| ||     | |                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |  |  || ||  ****|     | |      |  |       |              ****|       |   |   **** ****        |       | ****| |     |  |    |  |****           | |              | |    |    ||| |    | |        |  ||||||      | |             | |             ****                 ****  |    |  ****      |  |   | |       | |     |  |          | |      ..betaturn..| ||     | |                   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       | |  |  || ||  | | |     | |      |  |       |                | |       |   |        |  |        |       |   | | |     |  |    |  ||  |           | |              ***    |    ||| |    | |        |  ||||||      | |             | |                                  |  |  |    |  |  |      |  |   | |       | |     |  |          | |      ..gammaturn..| ||     | |                   
search RasMol script viewer Motif-ligand binding stats  nest ..       ***  |  |***|  | ***     | |      |  |       |                ***       |   |        |  |        |       |   | ***     |  |    |  ||  |           ***                     |    ||| |    ***        |  ******      | |             ***                                  |  |  |    |  |  |      |  |   | |       | |     |  |          | |      ..nest..| ||     | |                   
search RasMol script viewer Motif-ligand binding stats  niche ..            *********** | |     ***      ****       |                          |   |        ****        |       |   |         ****    ********                                   |    |****               |              ***                                                  *******    *******      ****   ***       | |     ****          ***      ..niche..****     ***                   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                        | |                         |                          *****                    |       |   |                                                            |    | |                 |                                                                                                            | |                            ..stmotif..| |                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                        | |                         |                                                   |       *****                                                            |    | |                 |                                                                                                            | |                            ..ststaple..| |                            
search RasMol script viewer Motif-ligand binding stats  stturn ..                        ***                         |                                                   |                                                                        |    ***                 |                                                                                                            ***                            ..stturn..***                            
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                    *                                                   *                                                                        *                        *                                                                                                                                           ..REP00000..                               

chain C : CYSTATHIONINE GAMMA-LYASE
member of: CATH:search3.40.640.10/search3.90.1150.10GENE3D:searchG3DSA_3.40.640.10/searchG3DSA_3.90.1150.10PANTHER:searchPTHR11808/searchPTHR11808_SF15PFAM:searchPF01053PIRSF:searchPIRSF001434PROSITE PATTERNS:searchPS00868, SUPERFAMILY:searchSSF53383UniProt:searchP32929
JMol viewer RasMol script viewer  NO3 607D  ..                                             ..                                                                                                                                                                                                                                                                                                                                                         
JMol viewer RasMol script viewer  GOL 605D  ..                                 *           ..                                                                                                                                                                                               **                                                                                                                                                        
JMol viewer RasMol script viewer  GOL 601D  ..                                 |           ..                                                                   *  **                                                                                                                       ||                                                                                                                                                        
JMol viewer RasMol script viewer  2AG 501D  ..                                 |           ..   * *                                                             |  ||                                                                                                                       ||                                                                                                                                                        
JMol viewer RasMol script viewer  PLP 500D  ..                                 |           ..   * *                                                             |  ||                                                                                                                       ||                                                                                                                                                        
JMol viewer RasMol script viewer  NO3 606C  ..                                 |           ..   | |                                                   *         |  ||                                *                                                  *                                   ||                                                                                          **             *                   *                          
JMol viewer RasMol script viewer  GOL 602C  ..                                 |           ..   | |                                    ***            |         |  ||                                |                                                  |                                   ||                                                                                          ||             |                   |                          
JMol viewer RasMol script viewer  2AG 501C  ..                                 |           ..   | |                                    |||            *    *    |  ||                                |                                                  |                                   ||                                                                                         *||             |                   |                          
JMol viewer RasMol script viewer  PLP 500C  ..                                 |           ..   | |                          ***       |||            *    |    |  ||                            *   *                         * *                   * **                                   ||                                                                                         |||             |                   |                          
sec str:  .........hhhhhhhhh..hhhhh................................hhhhhhhhhhhhhhhh..eeeee.hhhhhhhhhhh......eeeee...hhhhhhhhhhhhhhh..eeeee...hhhhhhhhh...eeeeeee..........hhhhhhhhhhhh...eeeee...hhhhhh........eeeee.............eeeee.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeee........hhhhhhhhh.....eeeeee..hhhhhhhhhhhh...ee.........eee..........hhhhhhhhh....eeeee....hhhhhhhhhhhhhhhhh...
sequence :  ..GFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQ..GFEYSRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHPPS
seq num:  ..10        20        30        40        50   ..57        67        77        87        97        107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |  | ||||||  |^**| |   | | ^**    | .. ||  |             || |||   |    | |  |||  | |  |    | | |  ^**  |   | |||  || |  |    |  || |||          ^**  |   |              | |  ||| |    ||||  |   ||  |||||       | |             | |  |  |       |  |          |    | |  |  |||  |  |  |      |  |   | |       | |     |  |   |  |  || ||| |      |  |       |||| ||     | |            |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |  | ||||||  | ||| |   | |        | ..***  |             || |||   |    | |  |||  | |  |    | | |       |   | |||  ^***  |    |  || |||          | |  |   |              | |  ||| |    ||||  |   ||  |||||       | |             | |  ^***       |  |          |    | |  |  |||  |  |  |      |  |   | |       | |     |  |   ^***  || |^***      |  |       |||| ||     | |            |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |  | ||||||  | ||| |   | |        ^*..**   |             || |^*****    ^*****||  | |  |    | | |       |   | |^***** |  |    |  || |||          | |  |   |              | |  ||| |    |^*****   ||  |||||       | |             | |             |  |          ^***** |  |  |||  |  |  |      |  |   | |       | |     |  |         ^*****        |  |       |^*****     | |            |       
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..       | |  | ||||||  | ||| |   | |          ..     |             || |||          |   ||  | |  |    | | |       |   | | |     |  |    |  || |||          | |  |   |              | |  ||| |    | ||      ||  |||||       | |             | |             |  |                 |  |  |||  |  |  |      |  |   | |       | |     |  |          | |          |  |       | || |**********************       
search RasMol script viewer Motif-ligand binding stats  CYS_MET_METAB_PP ..       | |  | ||||||  | ||| |   | |          ..     |             || |||          |   ||  | |  |    | | |       |   | | |     |  |    |  || |||          | |  |   |              | |  ||| |    | |*******^*******|       | |             | |             |  |                 |  |  |||  |  |  |      |  |   | |       | |     |  |          | |          |  |       | || ||     | |                    
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       | |  | ||||||  | ||| |   | |          ..     |             || |||          |   ||  | |  |    | | |       |   | | |     |  |    |  || |||          | |  *****              | |  ||| |    | |        |  |||||       | |             | |             |  |                 |  |  |||  |  |  |      |  |   | |       | |     |  |          | |          |  |       | || ||     | |                    
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |  | ||||||  | ||| |   | |          ..     |             || |||          |   ||  | |  |    | | |       |   | | |     |  |    |  || |||          | |                     ***  ||| |    | |        |  |||||       | |             | |             |  |                 |  |  |||  |  |  |      |  |   | |       | |     |  |          | |          |  |       | || ||     | |                    
search RasMol script viewer Motif-ligand binding stats  betabulge ..       | |  | ||||||  | ||| |   | |          ..     |             || |||          |   ||  | |  |    | | |       |   | | |     |  |    |  || |||          | |                     |    ||| |    | |        |  |||||       | |             | |             |  |                 |  |  |**  |  |  |      |  |   | |       | |     |  |          | |          |  |       | || ||     | |                    
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |  | ****||  ****| |   | |          ..     |             |****|          |   |**** ****    | | |       |   | | |     |  |    |  |****|          | |                     |    ||| |    | |        |  |||||       | |             | |             ****                 |  |  |    |  ****      |  |   | |       | |     |  |          | |          ****       | || ||     | |                    
search RasMol script viewer Motif-ligand binding stats  nest ..       ***  |  |***|  | *** |   | |          ..     |             |  ***          |   |     |  |    | | |       |   | ***     |  |    |  || |||          ***                     |    ||| |    ***        |  *****       | |             ***                                  |  |  |    |  |  |      |  |   | |       | |     |  |          | |          |  |       ***| ||     | |                    
search RasMol script viewer Motif-ligand binding stats  niche ..            *********** | ***   ***          ..     |             |    |          |   |     ****    *** |       |   |         ****    ********|                                  |    |****               |              ***                                                  *******    *******      ****   ***       | |     ****          ***          ****          ****     ***                    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                        | |                  ..     |             ******          |   |                 |       |   |                     | | |                                  |    | |                 |                                                                                                            | |                                              | |                             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                        | |                  ..     |                             |   |                 |       |   |                     *****                                  |    | |                 |                                                                                                            | |                                              | |                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                        | |                  ..     |                             *****                 |       *****                     | |                                    |    | |                 |                                                                                                            | |                                              | |                             
search RasMol script viewer Motif-ligand binding stats  stturn ..                        ***                  ..     |                                                   |                                 ***                                    |    ***                 |                                                                                                            ***                                              ***                             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                             ..     *                                                   *                                                                        *                        *                                                                                                                                                                                             

chain D : CYSTATHIONINE GAMMA-LYASE
member of: CATH:search3.40.640.10/search3.90.1150.10GENE3D:searchG3DSA_3.40.640.10/searchG3DSA_3.90.1150.10PANTHER:searchPTHR11808/searchPTHR11808_SF15PFAM:searchPF01053PIRSF:searchPIRSF001434PROSITE PATTERNS:searchPS00868, SUPERFAMILY:searchSSF53383UniProt:searchP32929
JMol viewer RasMol script viewer  NO3 607D  ..                                                                                                        *                                              *                                                  *                                                                                                                               **             *                   *                          
JMol viewer RasMol script viewer  GOL 605D  ..                                                                                                        |                                              |                                                  |      ***                             *                                                                                        ||             |                   |                          
JMol viewer RasMol script viewer  GOL 604D  ..                      ***                                                                               |                                              |                                                  |      |||                             |                                                                                        ||             |                   |                          
JMol viewer RasMol script viewer  GOL 601D  ..                      |||                                                                ***            |                                              |                                                  |      |||                             |                                                                                        ||             |                   |                          
JMol viewer RasMol script viewer  2AG 501D  ..                      |||                                                                |||            *    *                                         |                                                  |      |||                             |                                                                                       *||             |                   |                          
JMol viewer RasMol script viewer  PLP 500D  ..                      |||                                                      ***       |||            *    |                                     *   *                         * *                   * **      |||                             |                                                                                       ||*             |                   |                          
JMol viewer RasMol script viewer  NO3 606C  ..                      |||                                                      |||       |||            |    |                                     |   |                         | |                   | ||      |||                             |                                                                                       |||             |                   |                          
JMol viewer RasMol script viewer  GOL 602C  ..                      |||                                                      |||       |||            |    |       *                             |   |                         | |                   | ||      |||                             |                                                                                       |||             |                   |                          
JMol viewer RasMol script viewer  2AG 501C  ..                      |||                         * *                          |||       |||            |    |       |                             |   |                         | |                   | ||      |||                             |                                                                                       |||             |                   |                          
JMol viewer RasMol script viewer  PLP 500C  ..                      |||                         * *                          |||       |||            |    |       |                             |   |                         | |                   | ||      |||                             |                                                                                       |||             |                   |                          
sec str:  .........hhhhhhhhh..hhhhh................................hhhhhhhhhhhhhhhh..eeeee.hhhhhhhhhhh......eeeee...hhhhhhhhhhhhhhhh.eeeee...hhhhhhhhh...eeeeeee..........hhhhhhhhhhhh...eeeee.........hhhhhh..eeeee.............eeeee.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeee........hhhhhhhhh.....eeeeee..hhhhhhhhhhhh...ee.........eee..........hhhhhhhhh....eeeee....hhhhhhhhhhhhhhhhh...
sequence :  ..GFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHPPS
seq num:  ..10        20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |  |  || ||  |^**|     | | ^**    |  | ||  |                |||   |   ||  | | |  | |  |    | | |  ^**  |   | |||  || | ||    |  || |||          ^**  |   |   |  |       | |  ||| | |  ||||  |   ||  |||||       | |             | |  |  |       |  |          |    | | ||  |||  |  |  |  |   |  |   | |       | |     |  |   |  |  || ||| |      |  |       ||||  |     | |            |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |  |  || ||  | |||     | |        |  ^***  |                |||   |   ||  | | |  | |  |    | | |  ||   |   | |||  ^*** ||    |  || |||          | |  |   |   |  |       | |  ||| | |  ||||  |   ||  |||||       | |             | |  ^***       |  |          |    | | ||  |||  |  |  |  |   |  |   | |       | |     |  |   ^***  || |^***      |  |       ||||  |     | |            |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |  |  || ||  | |||     | |        ^*****   |                |^*****   |^***** |  | |  |    | | |  ||   |   | |^***** | ||    |  || |||          | |  |   |   |  |       | |  ||| | |  |^*****   ||  |||||       | |             | |             |  |          ^***** | ||  |||  |  |  |  |   |  |   | |       | |     |  |         ^*****        |  |       |^*****     | |            |       
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..       | |  |  || ||  | |||     | |                 |                | |       |   |   |  | |  |    | | |  ||   |   | | |     | ||    |  || |||          | |  |   |   |  |       | |  ||| | |  | ||      ||  |||||       | |             | |             |  |               | | ||  |||  |  |  |  |   |  |   | |       | |     |  |          | |          |  |       | ||  **********************       
search RasMol script viewer Motif-ligand binding stats  CYS_MET_METAB_PP ..       | |  |  || ||  | |||     | |                 |                | |       |   |   |  | |  |    | | |  ||   |   | | |     | ||    |  || |||          | |  |   |   |  |       | |  ||| | |  | |*******^*******|       | |             | |             |  |               | | ||  |||  |  |  |  |   |  |   | |       | |     |  |          | |          |  |       | ||  |     | |                    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |  |  || ||  | |||     | |                 |                | |       |   |   |  | |  |    | | *****   |   | | |     | ||    |  || |||          | |  |   |   |  |       | |  ||| | |  | |        |  |||||       | |             | |             |  |               | | ||  |||  |  |  |  |   |  |   | |       | |     |  |          | |          |  |       | ||  |     | |                    
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       | |  |  || ||  | |||     | |                 |                | |       |   |   |  | |  |    | | |  |    |   | | |     | ||    |  || |||          | |  *****   |  |       | |  ||| | |  | |        |  |||||       | |             | |             |  |               | | ||  |||  |  |  |  |   |  |   | |       | |     |  |          | |          |  |       | ||  |     | |                    
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |  |  || ||  | |||     | |                 |                | |       |   |   |  | |  |    | | |  |    |   | | |     ***|    |  || |||          | |          |  |       ***  ||| | |  | |        |  |||||       | |             | |             |  |               | | ||  |||  |  |  |  |   |  |   | |       | |     |  |          | |          |  |       | ||  |     | |                    
search RasMol script viewer Motif-ligand binding stats  betabulge ..       | |  |  || ||  | |||     | |                 |                | |       |   |   |  | |  |    | | |  |    |   | | |     |  |    |  || |||          | |          |  |       |    ||| | |  | |        |  |||||       | |             | |             |  |               | | ||  |**  |  |  |  |   |  |   | |       | |     |  |          | |          |  |       | ||  |     | |                    
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |  |  || ||  ****|     | |                 |                | |       |   |   **** ****    | | ****    |   | | |     |  |    |  |****|          | |          |  |       |    ||| | **** |        |  |||||       | |             | |             ****               | | ||  |    **********   |  |   | |       | |     |  |          | |          |  |       | ||  |     | |                    
search RasMol script viewer Motif-ligand binding stats  nest ..       ***  |  |***|  | ***     | |                 |                ***       |   |        |  |    | | |       |   | ***     |  |    |  || |||          ***          |  |       |    ||| |    ***        |  *****       | |             ***                                | | ||  |    |  |  |      |  |   | |       | |     |  |          | |          |  |       ***|  |     | |                    
search RasMol script viewer Motif-ligand binding stats  niche ..            *********** | |     ***                 |                          |   |        ****    *** |       |   |         ****    ********|                       ****       |    |****               |              ***                                                | *******    *******      ****   ***       | |     ****          ***          ****          ****     ***                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                        | |                         |                          *****                    |       |   |                     *****                                  |    | |                 |                                                                 |   |                                      | |                                                                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                        | |                         |                                                   |       *****                     | |                                    |    | |                 |                                                                 *****                                      | |                                                                              
search RasMol script viewer Motif-ligand binding stats  stturn ..                        ***                         |                                                   |                                 ***                                    |    ***                 |                                                                                                            ***                                                                              
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                    *                                                   *                                                                        *                        *                                                                                                                                                                                             

   New search    3cog:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors