triangle PDBeMotif: 3coa  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transcription/dna    | release date: Thu, Mar 27, 2008
Title crystal structure of foxo1 dbd bound to ire dna
Authors M.M.BRENT, R.ANAND, R.MARMORSTEIN
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Small molecules:    search CA CA binding statistics CA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains C,F sequence:
SKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNE
GTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : FORKHEAD BOX PROTEIN O1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF159PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchQ12778
JMol viewer RasMol script viewer  CA 1C  ..                                                             **    *                  
sec str:  ..........hhhhhhhhhhhh......hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh..eeee.........eeee..
sequence :  ..RRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNP
seq num:  ..156       166       176       186       196       206       216       226       236   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| |  |^***||  |  | || |||||   |    |  |  |  | | ^*** |  | ||^***|  |      || | |      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| |  | || ||  |  | || |**^*   |    |  |  |  | |      |  | || |  |  |      || | |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..* |  | || ||  |  | || | | |   |    |  |  |  | |      |  ^**| |  |  |      |^** |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  | |^***  |  | ^*** | |   |    |  |  |  | |      |     | |  |  |      |  | |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  | |  |   |  |  | | | |   |    |  |  |  | |      |     | |  |  |      ^*****      
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..  |  | |  |   |  |  | | | |   |    |  |  |  | |      ******* |  |  |      |  |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..  **** |  |   |  |  | | | |   |    |  |  **** |              |  |  |      |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..     | |  |   |  |  | *** |   |    |  |     | |              |  |  |      |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..     ***  |   |  ****     |   |    ****     ***              *******      ****        
search RasMol script viewer Motif-ligand binding stats  stmotif ..          |   |           *****                                                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..          *****                                                                       

chain A : DNA (5'-D(*DTP*DGP*DGP*DTP*DTP*DTP*DGP*DTP*DTP*DTP*DTP*DGP*DCP*DTP*DTP*DG)-3');
sec str:  ..................
sequence :  ..TGGTTTGTTTTGCTTG
seq num:  ..-4        7     

chain B : DNA (5'-D(*DCP*DAP*DAP*DGP*DCP*DAP*DAP*DAP*DAP*DCP*DAP*DAP*DAP*DCP*DCP*DA)-3');
sec str:  ..................
sequence :  ..CAAGCAAAACAAACCA
seq num:  ..13        23    

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain F : FORKHEAD BOX PROTEIN O1
member of: CATH:search1.10.10.10GENE3D:searchG3DSA_1.10.10.10PANTHER:searchPTHR11829/searchPTHR11829_SF159PFAM:searchPF00250PRINTS:searchFORKHEADPROSITE PATTERNS:searchPS00658, PROSITE PROFILES:searchPS50039, SMART:searchSM00339SUPERFAMILY:searchSSF46785UniProt:searchQ12778
JMol viewer RasMol script viewer  CA 2F  ..                                                              ** *  *                  
sec str:  ...........hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh..eeee.........eeee..
sequence :  ..SRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNP
seq num:  ..155       165       175       185       195       205       215       225       235    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |    |^*** ||    | || |||||   |    |  |  |  | | ^*** |  | ||^***|  |      || | |      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |    | ||  ||    | || |**^*   |    |  |  |  | |      |  | || |  |  |      || | |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..**    | ||  ||    | || | | |   |    |  |  |  | |      |  ^**| |  |  |      |^** |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | |^***|    | ^*** | |   |    |  |  |  | |      |     | |  |  |      |  | |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      | ||   |    |  | | | |   |    |  |  |  | |      |     | |  |  |      ^*****      
search RasMol script viewer Motif-ligand binding stats  FORK_HEAD_2 ..      | ||   |    |  | | | |   |    |  |  |  | |      ******* |  |  |      |  |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | ||   |    |  | | | |   |    |  |  **** |              |  |  |      |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..      | ||   |    |  | *** |   |    |  |     | |              |  |  |      |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..      ***|   |    ****     |   |    ****     ***              *******      ****        
search RasMol script viewer Motif-ligand binding stats  stmotif ..         *****             *****                                                       

chain D : DNA (5'-D(*DTP*DGP*DGP*DTP*DTP*DTP*DGP*DTP*DTP*DTP*DTP*DGP*DCP*DTP*DTP*DG)-3');
sec str:  ..................
sequence :  ..TGGTTTGTTTTGCTTG
seq num:  ..-4        7     

chain E : DNA (5'-D(*DCP*DAP*DAP*DGP*DCP*DAP*DAP*DAP*DAP*DCP*DAP*DAP*DAP*DCP*DCP*DA)-3');
sec str:  ..................
sequence :  ..CAAGCAAAACAAACCA
seq num:  ..13        23    

   New search    3coa:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors