triangle PDBeMotif: 3cfv  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification histone/chaperone    | release date: Tue, Mar 4, 2008
Title structural basis of the interaction of rbap46/rbap48 with histone h4
Authors A.VERREAULT, B.F.LUISI, E.D.LAUE, N.V.MURZINA, S.MCLAUGHLIN, W.ZHANG, X-Y.PEI
Method X-RAY DIFFRACTION (resolution: 2.60Å)
PDBe Citation   
Small molecules:    search ARS ARS binding statistics ARS
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains B,A sequence:
HMAMASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNH
LVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHP
AKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLL
HESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKD
EIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNI
MQIWQMAENIYNDE
Chains E,F sequence:
DNIQGITKPAIRRLARRG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : HISTONE-BINDING PROTEIN RBBP7
member of: CATH:search2.130.10.10GENE3D:searchG3DSA_2.130.10.10PANTHER:searchPTHR22850/searchPTHR22850_SF82PFAM:searchPF00400/searchPF12265PRINTS:searchGPROTEINBRPTPROSITE PATTERNS:searchPS00678, PROSITE PROFILES:searchPS50082/searchPS50294, SMART:searchSM00320SUPERFAMILY:searchSSF50978UniProt:searchQ16576
JMol viewer RasMol script viewer  ARS 412B  ..                                                                                 *          ..      *                                                                                                                                                                                                                                                                                                      
sec str:  .............hhhhhhhhhhhhhhhhhhhhhheeeeeeee.......eeeeeeee......eeeeeeeee.......eeeeeeeeeee........eeeeeeeeee.....eeeee..eeeeeeee.....eeeee.hhh.............eeee........eee......eeeee.....eeeee.........eee..eee......eeeeee......eeeeee...eeeeee..........eeee.....eeeeee......eeeeee...eeeeee........eeee.....eeeeee......eeeeee....eeeee.hhh....hhhhhh.....eeeee......eeeeee......eeeeee...eeeeeeehhhhhh.
sequence :  ..HMAMASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDD..VTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYND
seq num:  ..-2        8         18        28        38        48        58        68        78          ..110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       |  |||| |          | |||  |                 | | | || |         |  | ||               ..|| |   ||                |  |      | |    ||| |      | |   ||          |   ||^***|| |  || |    |||              |  |    ||   |  |  |  |  || |    |  |^***|                 | || |||     | |    || |  |      | ||       |  ^***|  | ||||     | || |  |  |    |  |||  | || |      | ||  |  |  || |      | || | 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..       |  |||| |          **^*|  |                 | | | || |         |  | ||               ..|| |   ||                |  |      | |    ||| |      | |   ||          |   ||||  || |  || |    |||              |  |    ||   |  |  |  |  || |    |  |  | |                 | || |||     | |    || |  |      | ||       |  |  ||  | ||||     | || |  |  |    |  |||  | || |      | ||  |  |  || |      | || | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       |  |||| |              |  |                 | | | || |         |  | ||               ..|^**   ||                |  |      | |    ||| |      | |   ||          |   ||||  || |  || |    |||              |  |    ||   |  |  |  |  || |    |  |  ^**                 | || |||     | |    || |  |      ^**|       |  |  ||  | ^**|     | || |  |  |    |  |||  | |^**      | ||  |  |  || |      | || | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       |  ||^***              |  |                 | | ^*** |         |  ^***               ..|      ||                |  |      | |    ||| |      | |   ||          |   ||||  || ^***| |    |||              |  |    ||   |  |  |  ^***| |    |  |                      | || |||     | |    || |  |      ^***       |  |  ||  ^*** |     | || |  ^***    |  |||  | |  |      | ||  |  ^***| |      | || | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       |  || |                |  |                 | |   |  |         ^*****                ..*      ||                |  |      | |    ||| |      | |   ||          ^*****||  ||     | |    |||              |  |    ||   |  |  |      | |    |  |                      | || |||     | |    || |  |                 |  |  ||     | |     | || |          |  |||  ^*****      | ||  |      | |      | || | 
search RasMol script viewer Motif-ligand binding stats  WD_REPEATS_1 ..       |  || |                |  |                 | |   |  |                               ..       ||                |  |      | |    ||| |      | |   ||              | ||  |***************|              |  |    ||   |  |  |      | |    |  |                      | || ||*************** |  |                 |  |  |*************** || |          |  |||  | |         | ||  |      | |      | || | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..       |  |***                |  |                 | |   |  |                               ..       ||                |  |      | |    *** |      | |   ||              ***|  |      | |    ***              |  |    ||   |  |  |      ***    |  |                      ***| ||      ***    |  |  |                 |  |  |      | |     | || |          |  |||  | |         ***|  |      | |      | || | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..       |  |                   |  |                 | |   |  |                               ..       **                |  |      | |     |  |      | |   **              |  |  |      | |                     |  |    **   |  |  |      | |    |  |                      |  | ||      | |    |  |  |                 |  |  |      | |     | || |          |  |**  | |         |  |  |      | |      | || | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..       |  |                   |  |                 | |   ****                               ..                         ****      | |     |  |      | |                   |  ****      | |                     |  |         |  |  |      | |    |  |                      |  | ||      | |    |  |  |                 |  |  |      | |     | || |          |  |    | |         |  ****      | |      **** | 
search RasMol script viewer Motif-ligand binding stats  nest ..       |  |                   |  |                 | |   |  |                               ..                         |  |      | |     |  |      ***                   |  |  |      ***                     |  |         |  |  |      ***    |  |                      |  | ||      ***    |  |  |                 |  |  |      ***     | || |          |  |    | |         |  |  |      ***        |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..       ****                   ****                 ***   ****                               ..                         ****      ***     ****                            *******                              ****         *******             ****                      *******             *******                 *******              ******          ****    ***         *******                 **** 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                            ..                                                                                                                                                                              ***                                                                                                                            

chain E : HISTONE H4 PEPTIDE
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR10484PFAM:searchPF00125PRINTS:searchHISTONEH4SMART:searchSM00417SUPERFAMILY:searchSSF47113UniProt:searchP62805
sec str:  ...hhhhhhhhhhhhhhhh.
sequence :  ..DNIQGITKPAIRRLARRG
seq num:  ..24        34      
search RasMol script viewer Motif-ligand binding stats  ststaple ..  *****           

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HISTONE-BINDING PROTEIN RBBP7
member of: CATH:search2.130.10.10GENE3D:searchG3DSA_2.130.10.10PANTHER:searchPTHR22850/searchPTHR22850_SF82PFAM:searchPF00400/searchPF12265PRINTS:searchGPROTEINBRPTPROSITE PATTERNS:searchPS00678, PROSITE PROFILES:searchPS50082/searchPS50294, SMART:searchSM00320SUPERFAMILY:searchSSF50978UniProt:searchQ16576
JMol viewer RasMol script viewer  ARS 412A  ..                                                                                *         ..      *                                                                                                                                                                                                                                                                                                     
sec str:  ............hhhhhhhhhhhhhhhhhhhhhheeeeeeee........eeeeeee......eeeeeeeee.......eeeeeeeeeee.......eeeeeeeeee.....eeeee..eeeeeeee.....eeeee.hhh.............eeee........eee......eeeee.....eeeee.........eee..eee......eeeeee......eeeeee...eeeeee..........eeee.....eeeeee......eeeeee...eeeeee........eeee.....eeeeee......eeeeee....eeeee.hhh....hhhhhh.....eeeee......eeeeee......eeeeee...eeeeeeehhhhhh
sequence :  ..MAMASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPND..VTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYN
seq num:  ..-1        9         19        29        39        49        59        69        79        ..110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..        | ||| |          | ||||||                 | | | || |         |  | ||              ..|| |   ||                |  |             || ||| | | |||   ||        | |   ||^***|| |  || |     |      | |       | |    ||   |  |  |  |  || |    |  |^***|                 | ||  ||     | |    ||||  |      | ||       |  ^***|  | ||||     | |  |  |  |    |  |||  | || |      | ||  |  |  || |            
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..        | ||| |          **^*||||                 | | | || |         |  | ||              ..|| |   ||                |  |             || ||| | | |||   ||        | |   ||||  || |  || |     |      | |       | |    ||   |  |  |  |  || |    |  | || |                 | ||  ||     | |    ||||  |      | ||       |  |  ||  | ||||     | |  |  |  |    |  |||  | || |      | ||  |  |  || |            
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | ||| |            ||||||                 | | | || |         |  | ||              ..|^**   ||                |  |             || ||| | | |||   ||        | |   ||||  || |  || |     |      | |       | |    ||   |  |  |  |  || |    |  | |^**                 | ||  ||     | |    ||||  |      ^**|       |  |  ||  | ^**|     | |  |  |  |    |  |||  | |^**      | ||  |  |  || |            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | |^***            ||||||                 | | ^*** |         |  ^***              ..|      ||                |  |             || ||| | | |||   ||        | |   ||||  || ^***| |     |      | |       | |    ||   |  |  |  ^***| |    |  | |  |                 | ||  ||     | |    ||||  |      ^***       |  |  ||  ^*** |     | |  |  ^***    |  |||  | |  |      | ||  |  ^***| |            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        | | |              ||||||                 | |   |  |         ^*****               ..*      ||                |  |             || ||| | | |||   ||        | ^*****||  ||     | |     |      | |       | |    ||   |  |  |      | |    |  | |  |                 | ||  ||     | |    ||||  |                 |  |  ||     | |     | |  |          |  |||  ^*****      | ||  |      | |            
search RasMol script viewer Motif-ligand binding stats  WD_REPEATS_1 ..        | | |              ||||||                 | |   |  |                              ..       ||                |  |             || ||| | | |||   ||        | |   | ||  |***************      | |       | |    ||   |  |  |      | |    |  | |  |                 | ||  |***************||  |                 |  |  |*************** |  |          |  |||  | |         | ||  |      | |            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | | |              *****|                 | |   |  |                              ..       ||                |  |             || ||| | | |||   ||        | |   | ||  |      | |            | |       | |    ||   |  |  |      | |    |  | |  |                 | ||  |      | |    | ||  |                 |  |  |      | |       |  |          |  |||  | |         | ||  |      | |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..        | ***              ||||||                 | |   |  |                              ..       ||                |  |             || ||| | | |||   ||        | |   ***|  |      ***            | |       | |    ||   |  |  |      ***    |  | |  |                 ***|  |      | |    ***|  |                 |  |  |      | |       |  |          |  |||  | |         ***|  |      | |            
search RasMol script viewer Motif-ligand binding stats  betabulge ..        | |                ||||||                 | |   |  |                              ..       **                |  |             || ||| | | |||   **        | |   |  |  |      | |            | |       | |    **   |  |  |      | |    |  | |  |                 |  |  |      | |    |  |  |                 |  |  |      | |       |  |          |  |**  | |         |  |  |      | |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |                *****|                 | |   |  |                              ..                         ****             ****|| | ****|             | |   |  ****      | |            | |       | |         |  |  |      | |    |  | |  |                 |  |  |      | |    |  |  |                 |  |  |      | |       |  |          |  |    | |         |  ****      | |            
search RasMol script viewer Motif-ligand binding stats  nest ..        | |                  |  |                 | |   |  |                              ..                         |  |              |  || |   ***             | |   |  |  |      ***            | |       | |         |  |  |      ***    |  | |  |                 |  |  |      ***    |  |  |                 |  |  |      ***       |  |          |  |    | |         |  |  |      ***            
search RasMol script viewer Motif-ligand binding stats  niche ..        ***                  ****                 ***   ****                              ..                         ****              *******                   ***   *******                     ***       ***         *******             **** ****                 *******             *******                 *******                ****          ****    ***         *******                     

chain F : HISTONE H4 PEPTIDE
member of: GENE3D:searchG3DSA_1.10.20.10PANTHER:searchPTHR10484PFAM:searchPF00125PRINTS:searchHISTONEH4SMART:searchSM00417SUPERFAMILY:searchSSF47113UniProt:searchP62805
sec str:  .....hhhhhhhhhh.
sequence :  ..GITKPAIRRLARRG
seq num:  ..28        38  
search RasMol script viewer Motif-ligand binding stats  nest .. ***          

   New search    3cfv:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors